KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_0746Help
Entry
Balac_0746        CDS       T00923                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:blc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:blc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:blc00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:blc00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:blc00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
879619..880251
Genome map
AA seq 210 aa AA seqDB search
MQGSIDIPLDEVGLWQVNQSAQSLIKLYVLPDPSRHQLVVSSDLERSMQTAHAFADRLGS
EVHADERLRERHFGEFEGRSGAYLQANFPQDFDSWCRGMGGEMNHGAESHEHAGVRSMEA
MNDWAHECDDDTDLFVFSHGALIENALQVLFGIERRYPDFTLTSMCNAHWARLRRADIDM
DSRWIMEDYNHGPALADTQYWERPDTLPAK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgcagggatcgatcgacattccgctcgatgaggtcgggctgtggcaggtgaaccagtcc
gcgcagtcactgattaagctatatgtgctcccagacccatctcggcaccagctcgttgtg
tcctccgacctcgaacgttcgatgcagacggcacatgccttcgccgatagactggggtcc
gaagtgcatgccgacgaacggttgcgcgagcggcatttcggtgaattcgaaggccgatcc
ggcgcatacctgcaggccaatttcccgcaggacttcgactcgtggtgccggggcatgggc
ggcgagatgaatcatggcgccgaatcccacgaacatgccggtgtccgcagcatggaggcc
atgaatgattgggcccatgaatgcgatgacgacaccgacttgttcgtattctcccatggc
gcgctcatcgaaaacgcgctgcaggtgctgttcggcatcgaacgacgatacccggatttc
acgctcacctcgatgtgcaacgcgcactgggccagactgagaagggccgatatcgacatg
gacagccggtggatcatggaggactacaaccatggacccgccctggccgatacacagtat
tgggagcgcccagacactttgccagcgaaatga

DBGET integrated database retrieval system