KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_0788Help
Entry
Balac_0788        CDS       T00923                                 

Definition
bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:blc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:blc00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:blc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
917455..919539
Genome map
AA seq 694 aa AA seqDB search
MSVLDELVAGALEDKCDRERVTSLEELKARAASAPAPLDAKRWLRRHDGIPVIAEIKRAS
PSKGHLIDIEDPAALGRQYEQGGASAISVLTEGRRFLGSLDDVDAVRAAVHIPVLRKDFI
TTDYQIWEARAHGADIVLLIVAALDDTQLAHLLKLTHELGMTALVETHTREEIERAIAAG
ARVIGINARNLKDLRVDVGKYTELASNLPEDVIKVAESGVFGAVEVEDYARAGADAVLVG
EGVATADDPRLAVERLVKAGERVKASETTPLSEHHGPYWGQFGGRYVPEALITALDELQR
VYDDAKDDPEFHKELATLNKRYVGRPSPLTEAPRFAERIKERTGLDARVFLKREDLNHTG
AHKINNAIGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDRILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPEMVRDF
QKIIGEEAKEQLAQWYGIDHPDAICACVGGGSNAIGIMNAFLDDPRVNLYGFEAGGHGPD
SGQHAIRFAPGTGELGMFQGAKSYLLGNSEGQTLDTYSISAGLDYASVGPEHAWLKEIGR
VNYSWATDEEAMNAFKDLCETEGIIPAIESSHAVAGAYKAARDLKEKGYEHPVMIVNISG
RGDKDMNTAGKWFGYLTDEQAAALEANGATGNNA
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggatgaactggtagcgggggcactcgaagacaagtgcgaccgtgaacgc
gtaacgtcgttggaagagctcaaggcccgggctgcctcggctccggctcccctcgacgcg
aaacgatggcttaggcgtcacgacggcattccggtgattgccgaaataaagcgtgcctcg
ccgtcgaaagggcatctcatcgatatagaagaccctgccgctttgggccgacaatacgaa
caaggcggtgcgagcgcaatctcggtgctcactgaaggccgcaggttcctcgggtctctt
gacgatgtcgatgccgtacgtgccgctgtgcacatcccggtgcttcggaaggatttcatc
accacggattaccagatctgggaggcgcgtgcgcatggggcggacatcgtgctgctcatc
gtcgcggcgcttgacgacacccagctggcgcatctgctgaagctcacgcatgaactcggt
atgaccgccttggtcgaaacgcatacccgtgaggaaatcgagcgggccatcgcggccggc
gcgcgtgtgatcggcatcaatgcgcgcaatctgaaggatttgcgcgtcgatgtgggcaaa
tacaccgagttggcgagcaatctgcccgaagatgtgatcaaggtggccgagtccggtgta
ttcggtgccgttgaagttgaggattatgcccgcgccggagccgacgctgttctggtggga
gagggcgtggccaccgccgatgacccgcggctggccgtggaacgattagtgaaggcagga
gaacgagtgaaagcttctgaaaccactccgttgagcgaacatcatggcccgtattggggg
cagttcggcggtcgctatgtgccggaggcgcttatcaccgccctcgatgaattgcagcgt
gtgtacgacgacgcgaaagatgatcccgaattccacaaggagctcgccacgctcaataag
cgctatgtgggacgtccttcaccgctcaccgaggcgccgcgattcgccgaacgcatcaag
gaacgcaccggactcgacgccagagtgttcctcaagcgtgaggacctcaaccataccggt
gcccataagatcaataatgcgatcgggcaggcactgctcgtcaagcgcatgggcaagacc
cgcgtgatcgcggagaccggagcaggacagcacggcgttgccacggccaccgtgtgtgcg
atgctcggtctcaagtgccgcatctacatgggacagatcgacgcacggcgacaggcgctc
aacgtggcccgcatgcgcatgctgggcgccgaggtggtcgaagtgacacttggtgaccgt
attctcaaggacgccatcaacgaggcgctgcgtgattgggtcaccaacgtcaaagacacc
cactatctgcttggtaccgtcgcaggtccccatccgttcccggagatggtgcgtgacttt
cagaagatcataggtgaggaggcgaaggagcagctggcacagtggtacggcatcgatcat
cccgatgcgatctgcgcctgcgtgggcggcggttccaatgccatcggcatcatgaacgcc
ttcctcgacgatccgcgcgtcaacctctatggtttcgaggctggcggccacggtccggac
tccggccagcatgccatccgtttcgcaccgggaaccggtgaactcggcatgttccagggg
gccaaaagctatctgcttgggaactctgagggacagacccttgacacctactcgatttcc
gcaggccttgattatgcgtccgttggcccagaacacgcatggctcaaggaaatcggacgt
gtgaactattcatgggcgaccgatgaggaagcgatgaacgcgttcaaggatctgtgcgag
accgagggcatcattccagccatcgagagctcccatgccgtcgccggcgcctataaagcg
gcacgggatctcaaggagaagggctatgagcatccggtgatgattgtgaacatctcggga
cgcggcgacaaggacatgaacaccgccggcaagtggttcggatatctcaccgatgagcag
gcagccgcactcgaggcgaacggtgcgaccggcaacaacgcgtga

DBGET integrated database retrieval system