KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_1017Help
Entry
Balac_1017        CDS       T00923                                 

Gene name
eno
Definition
(RefSeq) phosphopyruvate hydratase
  KO
K01689  
enolase [EC:4.2.1.11]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Balac_1017 (eno)
   01230 Biosynthesis of amino acids
    Balac_1017 (eno)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Balac_1017 (eno)
  Energy metabolism
   00680 Methane metabolism
    Balac_1017 (eno)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Balac_1017 (eno)
Enzymes [BR:blc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     Balac_1017 (eno)
Messenger RNA biogenesis [BR:blc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Balac_1017 (eno)
Exosome [BR:blc04147]
 Exosomal proteins
  Proteins found in most exosomes
   Balac_1017 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1161570..1162862)
Genome map
AA seq 430 aa AA seqDB search
MAAIESVYARQILDSRGNPTVEVVLDTDDGARGLGLVPSGASTGEAEAWERRDGDKSVYQ
GKGVLGAVKAVNEEIAPKVIGMDATDQRALDDLMIELDGTPNKGRLGANAILGVSLAALY
AAAESAELPLYRYIGGTNGHVLPVPNMNIMNGGAHADFATDIQEYMISPYGFQTYSEALQ
AGVEVYHTLKNVLKKQGLATGLGDEGGFAPKMKTNEDSLKYIMDAISAAGYEPGKQIGIA
LDVASSEFYNKETGKYHFDGEDRDSEYMLDFYEKLVDQFPIVSIEDPFQEEGWEDWAKIT
KALGDRLQFVGDDLFVTNPVRLKKGIDMGAGNSLLVKLNQIGTVSETLDAIELATKNGFT
SMVSHRSGETPDTTISDLAVAKNTGQIKTGAPARGERIAKYNRLLEIEEELGSTAEYAGY
SAFKACRKYM
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcaattgaaagcgtgtacgcacgccagattcttgattcccgcggcaacccgacc
gttgaggtcgtgctcgacaccgatgacggtgctcgcggcctgggtctcgttccctccggc
gcctccaccggcgaagccgaggcttgggagcgtcgcgatggcgacaagtccgtctatcag
ggcaagggtgtcctcggtgccgtcaaggcggtgaacgaggagatcgccccgaaggtcatc
ggcatggacgccaccgaccagcgcgcactcgatgacctgatgatcgagctcgacggcacc
ccgaacaagggccgtctgggcgccaacgccatcctcggtgtctccctcgccgccctttat
gcggccgccgagagcgccgaactgccgctgtaccgctatatcggcggcaccaacggccat
gttctcccggttccgaacatgaacatcatgaacggcggcgcacacgctgacttcgccacc
gacatccaggagtacatgatctccccgtacggcttccagacctactccgaggctctgcag
gccggcgtcgaggtgtaccacaccctcaagaacgtgctgaagaagcagggtctggccacc
ggtctcggcgatgagggcggcttcgctccgaagatgaagaccaacgaggattccctcaag
tacatcatggacgccatctccgccgccggctatgagccgggcaagcagatcggcatcgcc
ctcgatgtcgcctcctccgagttctacaacaaggagaccggcaagtaccacttcgatggt
gaggaccgtgattccgagtacatgctcgacttctacgagaagctcgtcgaccagttcccg
atcgtctccatcgaggatccgttccaggaggaaggctgggaagactgggccaagatcacc
aaggcccttggcgaccgcctgcagttcgtcggcgacgatctgttcgtcaccaacccggtg
cgtctgaagaagggcatcgatatgggcgccggcaactccctgctggtcaagctcaaccag
attggcaccgtttccgagaccctcgacgccatcgagctggccacgaagaacggcttcacc
tccatggtctcccatcgttcgggcgagacgccggacaccacgatctccgatctcgccgtc
gccaagaacaccggccagatcaagaccggcgccccggcacgtggcgagcgcatcgccaag
tacaaccgcctgctcgagattgaggaagagctcggttcgaccgccgaatacgctggctac
agcgcattcaaggcatgccggaagtacatgtga

DBGET integrated database retrieval system