KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_1025Help
Entry
Balac_1025        CDS       T00923                                 

Definition
B-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Balac_1025
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Balac_1025
Enzymes [BR:blc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Balac_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1174347..1175786
Genome map
AA seq 479 aa AA seqDB search
MPRFVKVSARFARSTLLSVASGAPPAAICARELYNDSSHRRNRGPMIQHNDKPQPNRNRR
MVRIVTTVIVTLAIVAIAIGAFAPVRHATDSDTTNGKAAPTSVPSRTSSPAPSTTISMPQ
TASPSPTPKTDGTSDRAKRIVEAMSLDERAGQLVMAALQYGNDPATLQAMIQEQHVGNVI
LMGNWVSGVENVARATQALQRLNASTGLPGLLIATDQEGGTVQHLSGPGFDAMPSATAQG
QMPLDRLRAAARDWALPLKRSGLAMNLAPSVDTVTIERAVNEPIGALYRDFGLDAQRNGE
HAAAFIEGMRAGGVGSAIKHYPGLGSVRGNTDFTANGIVDDTTTENGTEVNAFTSAIRQG
KPAMVMVSLATYKLIDPDNPAAFSPAIVTDMLRRGTPFDGVVISDSLSAGAVSSIAPQDL
GVRFIDAGGDICCMNAASYTQPILDGIRSRAAADKGFAAKVTASAERVVRLKIELGLVQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcttcgtcaaggtgtctgcgcgcttcgcgcgtagcacgctcctcagcgtggca
tccggcgccccaccggcggcaatctgtgcccgcgaactgtacaatgacagcagccatcgc
agaaaccgaggacccatgatccagcacaacgacaagccacagccgaaccggaacaggcgc
atggtccggattgtcacgaccgtcatcgtgacattggcaatcgtcgccattgcgattggg
gcattcgcaccggttcgccatgctaccgattccgacacgacgaatggcaaagccgccccg
acatcggttcccagccgcacatcatcgccagcccccagcacgaccatttccatgccgcag
acagcgtcgccttcgcccacccccaagacggatggcacctcggatcgggccaaacgcatt
gtagaggcgatgagcctcgacgaacgcgccgggcaattggtgatggccgcattgcaatac
ggcaatgaccctgccaccttgcaagcgatgattcaggagcagcatgtggggaacgtgatc
ctgatgggcaactgggtgagcggcgtcgagaacgtggcgcgtgccacacaggcactgcag
aggttgaacgcctccaccggattgccaggattgctcatcgccaccgatcaggagggcggc
acggtccagcatctttcgggaccgggattcgatgccatgcccagcgccacggctcagggt
cagatgccactcgaccggctgcgcgcagccgcgcgggattgggccctccccctcaaacgg
tccggtctcgccatgaatctggctccttcggtggacacggtgacgatcgaacgtgccgtc
aatgaaccgatcggcgcgctctaccgtgatttcggactcgatgcccagcgcaatggcgag
catgctgcagctttcatcgaaggcatgcgcgccggcggtgtgggcagtgccatcaagcat
tacccgggattgggatcggtgaggggcaacaccgatttcacggcaaacggcattgtcgac
gacacgacaaccgagaacggcacggaggtgaatgcattcacctctgcgatccggcagggc
aaacccgccatggtgatggtgtcgctggccacctacaaactcatcgaccccgacaatcct
gcagccttctcccccgccatcgtcaccgacatgctgcgcagaggtaccccgttcgacggc
gtggtgatctcggattccctctcggccggtgccgtgagctcgattgctccacaggatctg
ggcgtgcggttcattgatgcgggaggggacatctgctgcatgaacgccgcaagctatacg
cagccaattctggacggcatacgcagccgcgctgccgcggacaagggttttgccgccaag
gtcactgcgagtgccgaacgcgtggtgagactgaaaatagagctcggcttggtgcagtga

DBGET integrated database retrieval system