KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_1377Help
Entry
Balac_1377        CDS       T00923                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:blc00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:blc00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1614408..1615859)
Genome map
AA seq 483 aa AA seqDB search
MEFEKELKVTETNIPGLLVFDLPVHGDNRGWFKENWQKAKMTALGLPKDFQPVQNNVSFN
AKRGVTRGIHAEPWDKFISLATGEIFGAWVDLRPGDTFGQVYTTRLDPSKAIYVPRGVGN
SFQALEDGTAYTYLVNAHWSLEQKKTYTFVNLADPELNIQWPIPLEQAELSEADLHHPML
KDAKPMDPKRTLVTGANGQLGQSIRKYVEEHDLKGFEFTDIDEFDFSDPAAYEGYDWSLY
GTIINAGAFTAVDKAETPEGRVTAWKANALGPALLAKVATEHNLTLVHVSSDYVFDGTAK
VHDEDEAFSPLGVYGQTKAAGDIAVANAPKHYIVRSSWVIGNGHNFVKTMMMLSNKVSDP
NDALNEVTVVDDQYGRLTFTDDMAAAIFHLLDDEDPYGTYDLTGSGDVVSWAQIAAEVFA
MTNGNGDKVRPISTEQYFESAKAPVSPRPTNSTLDLAKIEETGYETTDWHDSLKAYVEVE
LKK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgaaaaggaactcaaggtcacggagacgaatattcccggcctgttggtcttc
gatttgccggtgcacggcgataaccgcggctggttcaaagagaactggcagaaggcgaag
atgacggcactcggcttgccgaaggacttccagccggtacagaacaatgtcagtttcaat
gcgaaacgcggtgtgacccgtggcatccacgccgagccatgggacaagttcatctcgctg
gccaccggcgagatcttcggtgcctgggtggatctgcgtccgggtgacaccttcgggcag
gtgtatacgacgcgccttgacccgtcgaaggcgatatatgtgccgcgcggggtgggcaac
agcttccaggcgttggaggatggcacggcctacacgtatttggtgaacgcgcattggtct
ctcgaacagaagaagacatacaccttcgtgaacctggccgacccggaactcaacatccaa
tggccgattccgcttgagcaggccgaactctccgaagcggacctgcatcacccgatgctc
aaggatgccaagccaatggatccgaagcgcacattggtcaccggtgcgaacggccagctt
gggcagtcgattcgcaagtatgttgaagagcatgatctcaaaggattcgaattcaccgac
atcgacgaattcgatttttcggatcctgccgcctatgaggggtatgactggagcctgtac
ggcacgatcatcaatgctggggcattcacggcggtggacaaggccgagacgcccgaaggg
cgtgtgacggcgtggaaggccaacgcacttggcccggcgctgctggcgaaagtggccacc
gagcacaatctgaccctcgtgcatgtaagctccgactatgtgttcgatggtaccgccaag
gtgcacgacgaagatgaggcattctcgccgcttggcgtatatggccagacgaaagctgcc
ggcgacatcgccgtcgccaacgccccgaagcactacatcgtgcgctcgagttgggtcatc
ggcaatgggcataatttcgtcaagacgatgatgatgctctcgaacaaggtgtctgatccg
aatgatgcattgaatgaggtgacggtggtggatgaccaatatggccgtctgacgttcacc
gatgacatggcagctgccatattccatctgctcgatgatgaggatccgtatggcacgtat
gatctcactggttccggtgacgtggtgagctgggcacagattgccgccgaggtgttcgcc
atgacgaatggcaatggagacaaggtgcgtccgatctccaccgagcagtacttcgagagc
gcgaaggctccggtgagcccacggccgacgaatagcacgctcgatttggccaagatcgag
gagaccggctatgagaccaccgattggcatgacagtctcaaggcctatgtcgaagtcgaa
ctgaagaagtga

DBGET integrated database retrieval system