KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_1501Help
Entry
Balac_1501        CDS       T00923                                 

Definition
PfkB family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Balac_1501
Enzymes [BR:blc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Balac_1501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1761002..1761970)
Genome map
AA seq 322 aa AA seqDB search
MNQILDKLEQIHGSVSVVGSMNADYTVTTERLPGPGETVTGGPLQVLPGGKSGNQAAAAA
KLGATVRMFGAVGSDSNADFLLTQLASAGVNTDGIRKVLGPSGTTVITVDSHGENTIVYS
PGSNANVTVEYIESQRDLLTASSVLGLCLESPLETVTACATMCHDAGMKVLLNDSPFIAT
LPSELIAHADILLVNEHELVQLLHIDEPEDDDWDSFDWAQAQNRLSEFGFDQAIVTLGGD
GSVVLDSTVDPSIIRIAPVRVDAVDTTGCGDSFMGTVLASLASGLSLEESAQLASYVSAY
AATGYGAQASYGTAAQIRERFR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagattctcgataagctggagcagattcacggatccgtctccgtggtcggttcg
atgaacgcagattacacggtgaccaccgagcggctccccgggccgggggagaccgtgacc
ggcggcccgctacaggtgctgcccggtggcaaatcgggcaatcaggccgccgctgccgcc
aagctcggcgccaccgtgcgcatgttcggtgcagtgggctccgactcgaatgcggatttc
ctgctgactcagctcgcatccgccggagtgaacaccgatggcattcgcaaggtgctcggc
cccagcggcacgacggtgatcactgtggattcccatggcgagaacaccattgtgtattcg
ccgggttccaacgcgaacgtgacggtggaatacatcgaatcccagcgcgatctgcttacc
gcatcgtcggtgctgggactgtgtttggaaagcccgcttgaaacagtgaccgcatgcgcg
accatgtgccatgatgcgggtatgaaggtgctgctcaacgattcgcccttcattgcgacg
ttgccgtccgaactcattgcgcatgccgacattctgctggtcaatgagcatgagctcgtg
cagctgctgcacattgacgagcctgaagatgatgactgggattcgttcgattgggcacag
gctcagaaccgtttgagcgagttcggttttgatcaggcgattgtgacgcttggcggcgac
ggttcggtggtgcttgactccacggtggatccatcgatcatccgcattgccccggtgcgt
gtggatgcggtggataccacgggctgcggcgattcgttcatgggcactgtgctggcttca
ttggccagtggactgagcttggaggagtccgcgcaactggcttcgtatgtgtcggcatat
gcggccaccggctatggtgcgcaggcctcctatggcaccgccgcgcagattcgggagcgc
ttccgctaa

DBGET integrated database retrieval system