KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00030Help
Entry
BLi00030          CDS       T00200                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bld00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BLi00030 (recR)
DNA repair and recombination proteins [BR:bld03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BLi00030 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32945..33541
Genome map
AA seq 198 aa AA seqDB search
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLSMKEDVVLDFAKALVNAKRNLTYCSVC
GHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGLYHVLHGAISPMDGIGPE
DIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDL
EYADEVTLSKALEGRREM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatcctgaaccaatatcaaagctgattgacagctttatgaaattgccaggaatc
ggacccaagacggcggtccgtctggctttttttgttcttagtatgaaagaagacgtcgtg
ttagattttgcaaaagcattggtaaacgcaaagcgcaatttgacatattgctcggtctgc
ggacatataacagatcaagatccttgctatatttgtgaagatacgagaagagacaaatcg
gtcatatgtgttgttcaggatcccaaagatgtcattgctatggagaaaatgaaggagtac
aacggactgtaccatgttttgcatggagcgatttctccgatggacggcatcggtccggaa
gatattaaaatacccgaattgctgaagcggttgcaggatgatcaggtgactgaagtcatt
ctcgcgacaaacccgaatatagaaggagaagcaacggccatgtacatttcaaggctttta
aagccgtctggtatcaagctgtcacgaattgcccatggacttccggtcggaggcgatttg
gagtatgcagatgaagtcactctttctaaagcgcttgaaggcagacgtgaaatgtag

DBGET integrated database retrieval system