KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00093Help
Entry
BLi00093          CDS       T00200                                 

Gene name
sul
Definition
dihydropteroate synthase Sul (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bld00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
90376..91233
Genome map
AA seq 285 aa AA seqDB search
MALQTAVRSKQLIAKQYTLSYEDKTLIMGILNVTPDSFSDGGKYNSIDRAVIHAKQMIED
GAHILDIGGESTRPGAEKVSLDEELSRVIPVIEKLVQEIDVPISVDTYKAQVADEAIKAG
AAIINDVWGAKADPDMARVAAAHNVPIILMHNREERNYKDLIPDMLSDLMECVSIAKSAG
VQDHHIVLDPGIGFAKTYHDNLAVMNQLEKFSEPGYPVLLGTSRKKFIGRVLDLPPEERA
EGTGATVCLGIQKGCDIVRVHDVKQISRMAKMMDAMIDKGGVYHR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttcaaacagcggtgcgttcaaagcaactgatcgcaaagcaatacacgttgtct
tatgaagataaaacattgatcatgggaattttaaatgtgacgcccgattctttttcagac
ggcggaaaatataacagcatcgatcgcgccgtcattcatgcaaaacaaatgatcgaagac
ggcgcccatatccttgatatcggaggagaatcgacgaggccgggggcggaaaaggtttct
cttgatgaagagctgtcaagagtcatacctgtaattgaaaaacttgttcaggaaatcgac
gtcccgatttccgttgacacttataaagcgcaagtggcagatgaagccattaaggccggt
gcagccatcatcaatgatgtctggggagcaaaagcagatcctgacatggcccgagttgcg
gccgctcataatgtgccgattatcttgatgcataaccgcgaggaacggaattataaggat
ttgatcccggacatgctgtctgatttgatggaatgtgtgagcattgcaaaatcagcaggc
gttcaggatcatcacatcgtacttgatcccggcatcggctttgccaaaacgtatcatgac
aatttggcggtcatgaatcagctcgagaagttcagcgaaccgggatacccggttttattg
gggacgtcacgaaaaaaatttatcggccgagtcctggatctgccgcctgaagaaagagcg
gaaggcacgggggcgacagtatgcctcggtattcaaaaggggtgcgatatcgtcagggtg
catgacgtcaagcaaatctccaggatggcaaaaatgatggatgccatgattgataaagga
ggcgtttatcatcgataa

DBGET integrated database retrieval system