KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00093Help
Entry
BLi00093          CDS       T00200                                 

Gene name
sul
Definition
dihydropteroate synthase Sul (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BLi00093 (sul)
Enzymes [BR:bld01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BLi00093 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
90376..91233
Genome map
AA seq 285 aa AA seqDB search
MALQTAVRSKQLIAKQYTLSYEDKTLIMGILNVTPDSFSDGGKYNSIDRAVIHAKQMIED
GAHILDIGGESTRPGAEKVSLDEELSRVIPVIEKLVQEIDVPISVDTYKAQVADEAIKAG
AAIINDVWGAKADPDMARVAAAHNVPIILMHNREERNYKDLIPDMLSDLMECVSIAKSAG
VQDHHIVLDPGIGFAKTYHDNLAVMNQLEKFSEPGYPVLLGTSRKKFIGRVLDLPPEERA
EGTGATVCLGIQKGCDIVRVHDVKQISRMAKMMDAMIDKGGVYHR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttcaaacagcggtgcgttcaaagcaactgatcgcaaagcaatacacgttgtct
tatgaagataaaacattgatcatgggaattttaaatgtgacgcccgattctttttcagac
ggcggaaaatataacagcatcgatcgcgccgtcattcatgcaaaacaaatgatcgaagac
ggcgcccatatccttgatatcggaggagaatcgacgaggccgggggcggaaaaggtttct
cttgatgaagagctgtcaagagtcatacctgtaattgaaaaacttgttcaggaaatcgac
gtcccgatttccgttgacacttataaagcgcaagtggcagatgaagccattaaggccggt
gcagccatcatcaatgatgtctggggagcaaaagcagatcctgacatggcccgagttgcg
gccgctcataatgtgccgattatcttgatgcataaccgcgaggaacggaattataaggat
ttgatcccggacatgctgtctgatttgatggaatgtgtgagcattgcaaaatcagcaggc
gttcaggatcatcacatcgtacttgatcccggcatcggctttgccaaaacgtatcatgac
aatttggcggtcatgaatcagctcgagaagttcagcgaaccgggatacccggttttattg
gggacgtcacgaaaaaaatttatcggccgagtcctggatctgccgcctgaagaaagagcg
gaaggcacgggggcgacagtatgcctcggtattcaaaaggggtgcgatatcgtcagggtg
catgacgtcaagcaaatctccaggatggcaaaaatgatggatgccatgattgataaagga
ggcgtttatcatcgataa

DBGET integrated database retrieval system