KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00198Help
Entry
BLi00198          CDS       T00200                                 

Gene name
rocF1
Definition
arginase RocF (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLi00198 (rocF1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BLi00198 (rocF1)
Enzymes [BR:bld01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BLi00198 (rocF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
176978..177892
Genome map
AA seq 304 aa AA seqDB search
MLKQQISMIGVPMDLGQLRRGVDMGPSAIRCAGVNERLECLCQDIEDLGDMTIGQREDEK
EGGEPASEELRNLKAITKASVKLAETVDNIVASGAFPLVLGGDHSIAIGTLAGLAKHYQN
LGVIWYDAHADLNTKETSPSGNIHGMPLAISLGIGHEGLTAIYGKEAKIKAENIVIIGAR
SLDDGEKELIRDKGIKVYTMHEIDRLGMTRVMEETIDYLRGRTDGVHLSLDLDALDPNDA
PGVGTPVAGGISYRESHLAMEMLEESKLITSAEFVEVNPILDEKNRTAEAAVALMGSLFG
EKLL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaacagcagatttcaatgatcggcgtgccgatggatcttggacagctgaggcgg
ggagtcgatatgggaccgagcgcgattcgctgtgcaggtgttaatgaacggctggaatgt
ctttgtcaggatattgaagacctcggcgatatgacgatcgggcaaagagaggatgagaaa
gaaggcggggagccggcatctgaagagctaagaaatttgaaagcgattacaaaagcgagt
gtaaaacttgctgagactgtcgataatatcgtagcttctggcgcttttccgctcgtgctg
ggcggtgaccacagcattgcgatcggaacgcttgccggccttgcgaagcattatcaaaac
ctgggtgtgatctggtatgacgcccatgccgatttaaatacaaaagaaacgtctccctca
ggcaacattcacggcatgccgctcgccatcagcctgggaatcggccacgaagggctgacc
gccatctatggaaaagaagctaaaattaaagcggagaacatcgtcatcatcggtgcgagg
tcacttgatgacggggaaaaagaattgattcgcgacaaagggatcaaagtatatacgatg
catgaaatcgaccgcctcggcatgacaagggtgatggaagaaacgatagactatttgcga
ggcaggacggacggtgtccatctgtcactcgatttggacgcgcttgatccgaacgatgca
ccgggtgtcggaactccggtagcaggaggcatcagctacagggaaagccatctggctatg
gaaatgcttgaggaatcgaagctgattacgtccgccgagtttgtcgaagtaaacccgata
ttggatgagaaaaacaggacggcggaagcggctgtagccttaatgggatcgctgtttggc
gaaaagctgctttag

DBGET integrated database retrieval system