KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00281Help
Entry
BLi00281          CDS       T00200                                 

Gene name
phoD
Definition
alkaline phosphatase D (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bld00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bld00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bld02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
255315..257036
Genome map
AA seq 573 aa AA seqDB search
MKKLSEESLKDNTFDRRRFIQGAGKIAGLSLGLAIAQSMGAMEVNAAPRFSEYPFTLGVA
SGDPLSDSVVLWTRLAPDPLNGGGMPNEAVSVKWELAEDERFRRVVKRGTEKATPHLAHS
VHAEVSGLKPNHVYYYRFKCGNQLSPVGKTKTLPAPGADVAKFTFAFASCQQYEHGYYTA
YQHMAKEKLDLVFHLGDYIYEYGPNEYVSKTGNVRTHSGPEIMSLLDYRNRHAQYRSDAN
LKAAHAAFPWVVTWDDHEVENNYANVIPEKGQSVEAFIKRRAAAYQAYYEHMPLRRQSLP
NGPDMQLYRNFSYGNLADISVLDTRQYRDDQANGDGNKPPSDESNDPKRTLLGAEQEAWL
FDNLSRSEAHWNIIAQQIFFAQWNFGTSAAPIYSMDSWDGYPAQRKRVIDFIKSQKLNNI
VVLTGDVHASWANNLLVDFDNPKSDIFGVEFVGTSITSGGNGADKRADTDKILSNNPHIK
FFNDYRGYVRCTVTPEEWRTDYRVVPYVTEPGAAVSTRASYVYHKDYTGLKRTASNIVPG
GVKKSNEVEEDRFLAHTRAHQKQVKQKEKKVTQ
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgagcgaggaaagcctcaaggacaatacgtttgaccgccgccgctttatt
caaggggccggcaaaatagccgggctttcgctcggacttgcgatcgcgcaatcgatgggg
gcaatggaagtcaatgcagcaccgaggttctccgaatatccgtttacacttggcgttgca
tcgggagatccgctttctgacagcgtcgtattgtggacaaggctggcgcccgatccgcta
aacgggggcgggatgccaaatgaagctgtatccgtgaaatgggagctcgcagaagacgaa
cgcttccgccgtgtcgtcaaacggggaaccgaaaaagcaacacctcaccttgcacattcg
gtacatgccgaggtatccgggctgaaaccgaatcatgtatactattaccgctttaaatgc
ggcaaccagctgagtcctgtcggcaagacaaagacgcttccggcgcccggggcagatgtt
gctaaattcacattcgcttttgcttcatgccagcagtacgaacacggctattataccgcc
tatcagcatatggcaaaggaaaagctcgatcttgtttttcatctcggcgactatatttat
gagtacggtccgaatgaatatgtttcgaaaacaggaaatgtcagaacacacagcggtcct
gaaatcatgtcactgctcgattaccgaaaccgtcatgcccaataccgttcagatgcaaac
ctgaaagctgcgcatgccgccttcccgtgggttgtcacatgggacgaccatgaagtggag
aacaactatgcgaatgtcatcccggaaaaaggccagtcagttgaagcgtttattaaacgg
cgcgccgccgcataccaagcttattacgagcatatgccgctccgccgccaatccttgccg
aacggtcctgatatgcaattgtaccggaatttttcctacggcaatttagctgacattagc
gtgctggatacccgtcagtatcgcgatgaccaggctaacggcgatggcaataagccgcct
tctgatgaatcgaatgatccgaagcggacgctgcttggagcggagcaggaggcttggctg
tttgacaatctgagtcgctccgaggcgcactggaacattatcgcacagcagattttcttt
gcgcagtggaactttgggacaagcgcggcgccgatttacagcatggattcgtgggacgga
tatcccgctcagcgcaagcgggtgatcgacttcatcaaatctcaaaaactgaacaacatc
gtcgtccttaccggtgatgtgcatgccagctgggcaaataatctgctcgttgattttgac
aatccgaaatcggacatctttggcgtggagttcgtcgggacgtcgattacatcgggagga
aacggcgctgataaaagagcggatacggataagattttatcgaacaatcctcatataaag
tttttcaatgattaccgcggctatgtgcgctgtacggtcaccccggaagaatggcggaca
gattaccgcgtcgtcccgtatgtgacagagccgggtgcggcggtttcgacaagagcttcc
tatgtttatcataaagactacacagggctgaaacggaccgcttccaacattgtgcctgga
ggcgtgaagaagtcaaacgaagtagaagaagaccgtttcctcgcacatacaagggcccat
cagaagcaagtgaagcaaaaggagaaaaaagtaacccagtaa

DBGET integrated database retrieval system