KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00424Help
Entry
BLi00424          CDS       T00200                                 

Gene name
rocF2
Definition
(GenBank) arginase RocF
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00220  Arginine biosynthesis
bld00330  Arginine and proline metabolism
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01130  Biosynthesis of antibiotics
bld01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BLi00424 (rocF2)
   00330 Arginine and proline metabolism
    BLi00424 (rocF2)
Enzymes [BR:bld01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BLi00424 (rocF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AAU39380
Position
424065..424958
Genome map
AA seq 297 aa AA seqDB search
MNKQVSLIGMPMDLGQARRGVDMGPSAIRYAHIVERLNELGYDIDDLGDVPINRDQPKGD
EGLKNLVSVLEGNRKLADIVDNVVEQRRFPLVLGGDHSIAIGTLAGVAKHYQQLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGVGHEKLVNLHGYAPKIKPEHVVIIGARSLDEGER
KYIRETGMKVYTMHEIDRLGMTKVMEETIEYLSANCDGIHLSLDLDGLDPSDAPGVGTPV
VGGISYRESHLAMEMLYDADIITSAEFVEVNPILDHKNKTGEAAVELIESLLGKKLL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaagtttctttgattggaatgccgatggacttggggcaggcgcggcgcggt
gtggatatgggaccgagcgcgattcgctacgctcatatcgtggagcgcttaaacgagctg
ggctatgatatcgatgatctgggcgatgtgccgatcaaccgcgatcagccaaaaggagac
gaagggctgaaaaatttagtttccgtactggaaggaaaccgcaagctggccgatatcgtc
gacaatgtcgtcgagcagcgccgcttcccgctcgtgctgggcggagaccacagcattgcc
atcgggacattggcgggtgtagccaagcattatcaacagctcggcgtgatttggtatgac
gcacacggagacctaaatacgcttgagacatcgccgtcaggcaacatccacggcatgccg
ctggcggtaagtctcggtgtcggccacgaaaagctggtcaacctccacggctatgcgccg
aaaatcaaaccggagcacgtcgtcatcatcggtgcgcgctcgcttgatgaaggagagcgc
aaatatatccgtgaaaccggcatgaaagtctataccatgcatgaaattgacaggctcggc
atgacgaaggtaatggaggaaacgatcgagtatttgtcagcaaattgcgacggcatccat
ctgagccttgatctggacggtcttgatccgagtgacgctccgggagtcggcacccctgtc
gtcggaggcatcagctacagggaaagccatttggcgatggaaatgctctatgacgcagat
atcattacatccgccgagtttgttgaagtcaacccgatactggatcataaaaataaaacc
ggtgaggcggccgtcgaactgatcgaatcattgttagggaagaaactgctgtaa

DBGET integrated database retrieval system