KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00486Help
Entry
BLi00486          CDS       T00200                                 

Gene name
nasF
Definition
uroporphyrinogen-III C-methyltransferase NasF (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bld00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492658..494118
Genome map
AA seq 486 aa AA seqDB search
MGNGKVYFVGAGPGDSGLITLKGRTLIEAADVILYDRLVNSRLLEHAKASCEFVYCGKLP
DRHYMRQSEINALLIEKGLKGLKVVRLKGGDPSVFGRVGEEAAAVSEHGIPYEMVPGITS
GIAAPLYAGLPVTHRDFASSFAVVTAHDKSGKPEMNWEGLAKGVQTLVFYMGIKNLGYIC
EQLMKHGKSPLVPAMAIQWGTWGRQRSVKGTLQNIREKITEHQIKNPAIIVIGDIVSFRQ
NSWFEEKPLIGLNIMAVKSCEEEQIPVEALREQGAEVVEWPKWKSAETVPDDALLGRIAC
FDSLLFTSSASLRRFFSRLAALKIDVREMRGRLYASDQHVKAALEERGFEAFLQTEMPVS
GSCLLIGSREAVQNYPHSGCEVLITHDRVIDSRFTSIIKREIDEFPIDIVLFSNRTCVEL
FVNEAETVGLHPEKTAARLQAFCLTEEAGERAAAVGFQRVHAVNDRDRLPDVIKEINRTA
EFVCQS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgggaaagtttattttgtcggggccggaccgggcgattcaggattgatcaca
ttaaaaggaagaacgctgatcgaggcggcggatgtcatattgtatgacaggctcgtcaat
tcccggctgcttgagcatgcaaaagcatcatgcgaatttgtctactgcggcaagctcccg
gaccgccattatatgaggcaaagtgaaatcaatgcactgctcattgaaaaggggctgaaa
ggcctcaaagtggtccggctgaaaggaggagacccgagcgtgtttggcagagtcggggaa
gaagcggccgccgtcagcgaacacggcatcccgtacgagatggtgccaggcattacatcg
ggaatcgccgctcctctttatgccggactgcctgtgacccaccgcgatttcgcttcatcc
tttgccgttgtcaccgcccatgataaatcgggcaaaccggagatgaattgggaagggctg
gccaagggcgtccaaaccctcgtcttttacatggggatcaaaaaccttggttatatatgc
gagcagctgatgaaacacggcaagtccccccttgttcccgcaatggccatccaatggggc
acatggggccggcagcggagtgttaaagggacattgcagaatatcagggagaaaataacc
gagcatcagatcaaaaatcccgcgattatcgtcatcggcgacatcgtatcattcaggcag
aacagctggtttgaagaaaagcctttgatcgggctgaacatcatggcagtcaaaagctgt
gaagaagaacaaattccagtggaggcgcttcgtgaacaaggcgctgaagttgtggaatgg
ccgaaatggaaatcggccgaaacggtgcctgacgatgcacttttaggtcgaatcgcttgt
tttgacagcctgctgttcacctcaagtgcgtcactgcgcagatttttcagccggcttgct
gctttgaagatcgatgtcagggaaatgcgcggaaggctttacgcttcagatcagcatgta
aaagcagctcttgaagaacggggatttgaagcctttctgcaaacggaaatgccggtctcg
ggcagctgtttgctgatcggcagccgggaagccgtgcaaaattacccgcactccgggtgc
gaggtattgattacacatgacagggtgatcgacagccgctttacctcgatcatcaaacgg
gaaattgatgagtttcctattgatatagtgttgttttcaaatcgaacatgcgtcgagctg
ttcgtaaacgaggcggagacagtcggcctccatccggaaaaaacggctgcccgtcttcag
gcgttctgcctcactgaagaagcgggggagagagctgcagccgtagggtttcagcgcgtt
catgcagtgaatgatcgcgatcgcctgccggatgtcatcaaagagatcaaccgaacagcc
gaatttgtctgtcagagctga

DBGET integrated database retrieval system