KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00584Help
Entry
BLi00584          CDS       T00200                                 

Definition
(GenBank) putative ureohydrolase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00220  Arginine biosynthesis
bld00330  Arginine and proline metabolism
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01130  Biosynthesis of antibiotics
bld01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BLi00584
   00330 Arginine and proline metabolism
    BLi00584
Enzymes [BR:bld01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BLi00584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AAU39533
Position
complement(582153..583067)
Genome map
AA seq 304 aa AA seqDB search
MAKKTIRLLMPQWQGGNNPNYSFGAELLAWLAPENDQPLIHVPVQPYDGTPLENENGING
RKQLLEQLEAAQHIIHAHKPDRIVMFGGDCLVEQAPFAYLNERYGGDLGLIWIDAHSDLV
RYAGYDNGHTLPLGNLLGEGDEEFAKHVKIPLKPENVFIAGLAAPTEEETKVISNELQRQ
GIAPTEPDTEVIQRLGIRTAGTKKLMTSTEPIKEWIKESNIKYLAIHLDLDVLDPKAFRS
LLFANPEAPVNFSPEGTMQMPYLLHLLKELSSETDVVGLGITEHLPWDSIHLKKLLSEIP
ILTQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaacaattcgtctgttaatgccgcaatggcaagggggaaacaatcccaac
tactcttttggagcagaactgcttgcttggctggctcctgaaaatgatcagccccttatt
catgttccggttcaaccttatgatggaactccgcttgaaaacgaaaacgggataaacggg
agaaaacaactgctggaacaattggaggctgctcagcatatcattcatgctcataagccg
gatcgcattgtcatgtttggcggtgactgcttagtcgaacaagcaccatttgcttattta
aacgaacgatacggcggggacttaggtttaatttggattgacgctcatagcgatttagtt
agatatgccggttatgacaacggtcatacattaccgctcgggaatcttttgggagaagga
gatgaagagttcgcaaaacatgtgaaaattcccctgaaacctgaaaatgtctttattgcg
ggattagcagctcctacagaagaagaaacaaaagtgatatcaaatgaacttcaaagacaa
ggtatagctcccacagaaccagacactgaagtgattcaaagacttgggattagaactgcc
ggaactaaaaagttaatgaccagtaccgaacctataaaagaatggataaaagaaagcaac
atcaagtatctggcaatacaccttgatttagacgtgcttgatccgaaggcgtttcgttct
ttattattcgccaatcctgaagcacctgtaaatttttctcctgagggaacaatgcaaatg
ccgtacctgcttcatcttctgaaagaactctcttccgaaacggatgtggttggattaggt
ataaccgagcatttgccgtgggattctattcatttgaagaaattgcttagtgaaatccct
attttaacccaataa

DBGET integrated database retrieval system