KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00584Help
Entry
BLi00584          CDS       T00200                                 

Definition
ureohydrolase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bld01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bld00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(582153..583067)
Genome map
AA seq 304 aa AA seqDB search
MAKKTIRLLMPQWQGGNNPNYSFGAELLAWLAPENDQPLIHVPVQPYDGTPLENENGING
RKQLLEQLEAAQHIIHAHKPDRIVMFGGDCLVEQAPFAYLNERYGGDLGLIWIDAHSDLV
RYAGYDNGHTLPLGNLLGEGDEEFAKHVKIPLKPENVFIAGLAAPTEEETKVISNELQRQ
GIAPTEPDTEVIQRLGIRTAGTKKLMTSTEPIKEWIKESNIKYLAIHLDLDVLDPKAFRS
LLFANPEAPVNFSPEGTMQMPYLLHLLKELSSETDVVGLGITEHLPWDSIHLKKLLSEIP
ILTQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaacaattcgtctgttaatgccgcaatggcaagggggaaacaatcccaac
tactcttttggagcagaactgcttgcttggctggctcctgaaaatgatcagccccttatt
catgttccggttcaaccttatgatggaactccgcttgaaaacgaaaacgggataaacggg
agaaaacaactgctggaacaattggaggctgctcagcatatcattcatgctcataagccg
gatcgcattgtcatgtttggcggtgactgcttagtcgaacaagcaccatttgcttattta
aacgaacgatacggcggggacttaggtttaatttggattgacgctcatagcgatttagtt
agatatgccggttatgacaacggtcatacattaccgctcgggaatcttttgggagaagga
gatgaagagttcgcaaaacatgtgaaaattcccctgaaacctgaaaatgtctttattgcg
ggattagcagctcctacagaagaagaaacaaaagtgatatcaaatgaacttcaaagacaa
ggtatagctcccacagaaccagacactgaagtgattcaaagacttgggattagaactgcc
ggaactaaaaagttaatgaccagtaccgaacctataaaagaatggataaaagaaagcaac
atcaagtatctggcaatacaccttgatttagacgtgcttgatccgaaggcgtttcgttct
ttattattcgccaatcctgaagcacctgtaaatttttctcctgagggaacaatgcaaatg
ccgtacctgcttcatcttctgaaagaactctcttccgaaacggatgtggttggattaggt
ataaccgagcatttgccgtgggattctattcatttgaagaaattgcttagtgaaatccct
attttaacccaataa

DBGET integrated database retrieval system