KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00749Help
Entry
BLi00749          CDS       T00200                                 

Definition
glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLi00749
Enzymes [BR:bld01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BLi00749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
759482..760951
Genome map
AA seq 489 aa AA seqDB search
MMTKTKGFPKDFLWGGAIAANQAEGAWNVDGKGPSVADIAMYRSNLSVEDYEGHLAVSSE
NIERAMKDPDVKKYPKRRGIDFYHHYKEDVALFAEMGFKTLRISIAWSRIFPTGEEAEPS
EKGLQFYDRLFQEMKKHNIEPIVTLSHYEMPLALSLKYNGWVERKVIDLFVKFANVCFER
YKDVVKYWLTFNEIDSIHRHSFITAGIIPDRCPEGKVEETVYQALHHQFVASALVTADCH
RIIPGSQVGCMLTKLTTYPHTCHPSDVERALKQNLDNYFYADVQVFGEYPPLIKRMLERK
NINIKMEADDLAIIKEHTVDFVSFSYYMSLTESAQEGLEKTDGNTIRGVKNPYLPSTDWG
WQIDPVGLKISLIELYDRYQKPLIIVENGMGAKDVVESDGSIHDDYRISYFREHFRQMKE
AIEEGVDLFGYTSWGPIDIISAGTSQMSKRYGFIHVDQDDDGNGTLKRSRKDSFYWYKKV
IETNGEVLD
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaaaaacaaaaggatttccaaaagattttttatggggcggtgcgattgccgca
aaccaagcagaaggagcctggaatgttgatggaaaaggaccgtctgttgctgatattgcc
atgtaccgttcgaatttgagtgttgaagattacgaaggacatcttgctgtttcttctgaa
aacattgaacgcgcaatgaaagacccggacgtaaaaaaatatccgaagcgcagagggatt
gacttttatcatcactataaagaagatgtggctctctttgcagaaatgggttttaaaaca
ttgcgtatatcgattgcatggagccgaattttcccgacaggagaagaagcagagcctagc
gagaaaggccttcagttttatgatcgtctgtttcaagaaatgaaaaaacataacattgaa
ccgatcgtgactctgtcacattatgaaatgccattagcacttagtctgaaatacaacgga
tgggttgaaagaaaagtgatcgacctctttgtgaaatttgccaatgtgtgttttgaacgc
tataaagatgtcgtaaaatactggcttacctttaatgaaattgacagtatacatcgccat
tctttcattacagcgggaatcattcctgatcgctgtcctgaagggaaagtagaagaaacg
gtttatcaagcattgcaccatcaatttgtggcatccgctcttgtgactgcagattgtcat
cgcatcattcccggcagtcaggtgggatgtatgctaacgaaactcacgacatacccgcac
acttgccatccgagtgatgttgaacgcgcactgaagcaaaaccttgataactatttctat
gcagatgttcaagtgtttggcgaatatccgccattgatcaaacgcatgctggaacgaaaa
aatatcaatattaagatggaagcggacgatcttgccattataaaagaacatacggtagac
ttcgtttcgtttagctactatatgtccctgacagaatctgcacaggagggtctggaaaaa
acagatggcaatacgattcgcggtgtgaaaaatccatatttgccgtcaacagattggggt
tggcaaatcgatccggtcggcttaaagatttcgctcattgaattgtatgatcgctatcaa
aaacctctcattattgtggagaacggcatgggtgcgaaagatgttgtcgaaagcgatgga
tcgatccatgatgactatcgtattagctatttcagagagcatttccgtcagatgaaagaa
gccattgaagaaggtgttgatctctttggatataccagctggggacccattgacattatt
agtgcgggaacatctcaaatgtccaaacgatatggatttatccatgttgatcaagatgac
gatggcaacgggacattgaagcgctcacgtaaagattcattctactggtataagaaagtg
attgagacaaacggagaagtattagactaa

DBGET integrated database retrieval system