KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00995Help
Entry
BLi00995          CDS       T00200                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bld00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
997397..998887
Genome map
AA seq 496 aa AA seqDB search
MEKYILSLDQGTTSTRAIVFNKAGEIVHIAQKEFRQYFPNPGWVEHNANEIWGSVLSVIA
SALSESGIEAGQIAGIGITNQRETTVVWDKHTGKPVYNAIVWQSRQSAEICQELKEKGYE
ETIREKTGLLIDPYFSGTKVKWILDHVEGAREKAENGDLLFGTIDSWLIWKMSGGKAHVT
DYSNASRTLMFNIYDLKWDDELLDILGVPKSMLPEVKPSSHVYAETVDYHFFGKNIPIAG
AAGDQQAALFGQACFEEGMVKNTYGTGCFMLMNTGEKAIKSEHGLLTTIAWGIDGKVEYA
LEGSVFVAGSAIQWLRDGLRMFKDAKESEKYAVRAESADGVYVVPAFVGLGTPYWDSDVR
GAVFGLTRGTTKEHFIRATLEALAYQTKDVLDAMKEDSGIPVKTLRVDGGAVKNNFLMDF
QGDILDVPVERPEINETTALGSAYLAGLAVGFWSDRSEIKDQWQLDKRFEPKMEEKERES
LYNGWKKAVNAARAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtacattttgtctcttgatcaaggcaccacaagcacaagggcgattgttttc
aacaaagcaggcgaaatcgtccatattgcgcaaaaggaattccggcaatattttccaaac
cctggctgggttgaacacaatgcaaacgaaatctggggctctgttctgtcggtgatcgct
tcagcgctttcagaatcggggatcgaagccggacaaattgccggaatcgggatcacaaac
cagcgggaaacgaccgtggtttgggataaacataccggcaaaccggtctacaacgcgatt
gtgtggcagtcccgccaatcggctgagatatgccaggaattaaaagagaaaggctatgaa
gagacgatcagagaaaaaacagggcttttaatcgatccttatttttcaggcacgaaagtg
aaatggatcctggatcatgtggaaggggcaagggagaaagccgaaaacggcgaccttctc
ttcggtacgatcgattcttggctgatctggaaaatgtccggcggaaaagcgcatgtgaca
gattattcaaacgcctcaagaacattgatgttcaacatctatgacctaaaatgggatgat
gaacttctcgatattctcggcgtgccgaaatcgatgcttccggaagtcaagccttcatcg
catgtatacgctgaaacggtcgattatcatttcttcggcaaaaacattccgattgcaggt
gcagccggcgaccagcaggcagcattgttcgggcaggcttgctttgaagaaggaatggtt
aagaacacgtatggaacaggctgctttatgctgatgaacaccggcgagaaagcgattaaa
tcagagcacggcctgctgacgacaatcgcttggggcatcgacggaaaggtggaatatgcg
ctggaaggcagcgtcttcgtcgcgggttccgctattcaatggctgcgtgatgggctgaga
atgtttaaagacgccaaagaaagtgaaaaatacgctgtaagagcagaatctgccgatggt
gtttatgtggtccctgcatttgtaggtttaggcacgccttattgggacagcgatgtccgc
ggcgctgtattcggactgacccggggtacgacgaaagagcattttatcagagcaacgctt
gaagcgcttgcctatcaaacgaaagacgtgctggacgcaatgaaggaagactccgggatc
ccggttaaaacgctgagagtcgacggcggagctgtcaaaaacaacttcctgatggatttt
cagggcgacattttagatgtccctgtagaacgtcctgaaatcaatgaaacaacagcgctt
ggttcagcctatttagcgggccttgctgtcggcttctggagcgatcgttccgagatcaaa
gaccagtggcagcttgacaaacgttttgaaccgaaaatggaagaaaaagagcgtgagagc
ctgtacaacgggtggaagaaagctgtaaatgcagctagggcttttaaataa

DBGET integrated database retrieval system