KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi01094Help
Entry
BLi01094          CDS       T00200                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bld00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1093070..1094482
Genome map
AA seq 470 aa AA seqDB search
MSGERRQIVIIGGGITGLAAAFYLEKEIKKNDLPAEVTLVEASPRLGGKMQTVHKDGYVI
ERGPDSFLERKQSAPQLVKDLGLEHLLVNNATGQSYVLVSETLYPIPEGAVMGVPTKIGP
FLTTGLFSLPGKLRAGMDLVLPASKPQEDQSLGEFFRRRVGGEVVENLIEPLLSGIYAGD
IDRLSLMSTFPQFYQTEQKYRSLIIGMKKSRGAQSVGKPANKKKGQFQTVKTGLQTIVEE
LEKQLGITKVYKGTKVVSIERAGSAYSMKLDNGKVLHADSAVVTAPHKAAAAMFQKEDWL
KGLEDMVSTSVANVALGFPEEAVQMEHQGTGFVISRNSDFSITACTWTNKKWPSTTPEGK
VLLRAYVGKAGDESVVEQSDNEMVKIVLDDLKRIMKIDGEPEMTCITRWHEAMPQYHVGH
KKRIKEIREGLEASYPGVFITGASFEGVGIPDCIDQGKQAVADVLSHLFE
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagaacgcaggcagattgtcatcatcggcggcggtattaccgggttggccgcc
gccttctacttggagaaggaaatcaaaaagaatgatctcccggccgaagtcacgcttgtt
gaagcaagcccgagactgggcggaaagatgcagacggtacacaaagacggctatgtgatt
gaacggggtccggattcatttttggaacggaaacaaagcgcacctcagctcgtgaaggat
ctcggactggagcatttgcttgtgaacaatgcgactggccagtcttatgtgcttgtcagc
gaaacgctctatccgattccggaaggagccgtgatgggggtgccgacaaaaatcggtcct
tttctgacaaccggcttgttttccttgccggggaagttgagagccggaatggatttggtg
cttccagcaagcaagccgcaggaagaccaatcgctcggagaatttttcagaaggcgcgtc
ggcggtgaagtggtggagaacctgatcgaaccgcttttgtcaggcatttatgccggggac
atcgaccgtctcagtctgatgtcgactttcccgcagttctatcagacagagcagaagtac
agaagcttgatcatcgggatgaaaaaatcgcgcggcgcccagagcgtcggaaagcctgca
aacaaaaagaaaggccagttccagacggtgaaaaccggcctgcagacgatagttgaagaa
ttggaaaagcagctcggcatcacaaaggtttataaaggcacaaaggtcgtcagcattgag
cgtgcgggctcggcttacagcatgaagcttgacaacggcaaggtgcttcacgccgattcg
gccgtggtcaccgctcctcataaagcagctgccgcgatgtttcaaaaagaggattggctg
aagggtttagaggatatggtgtcaacatctgtcgccaatgtggcgctcggatttccggaa
gaagccgtccaaatggagcatcaaggcacgggctttgtcatttcaagaaacagcgatttt
tccattacggcgtgtacctggacaaacaaaaaatggccgagcacaacgcctgaaggaaaa
gtcctgctaagggcttatgtagggaaagccggcgatgagtccgttgtcgaacagtctgat
aacgaaatggtgaaaatcgtcctcgacgatttaaaacggattatgaagatcgacggcgaa
ccggaaatgacctgcatcacaagatggcatgaagcgatgccgcaataccatgtcggccat
aagaaaagaattaaagaaatcagggaaggcttggaagcgtcctatccgggtgttttcatt
acgggggcctcatttgaaggggtcggcatccctgattgcatcgaccaaggcaagcaggcc
gtcgccgatgtactctcgcaccttttcgaataa

DBGET integrated database retrieval system