KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi01109Help
Entry
BLi01109          CDS       T00200                                 

Gene name
apr
Definition
subtilisin Carlsberg (EC:3.4.21.62)
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Brite
Enzymes [BR:bld01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     BLi01109 (apr)
Peptidases [BR:bld01002]
 Serine Peptidases
  Family S8: subtilisin family
   BLi01109 (apr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1108966..1110105)
Genome map
AA seq 379 aa AA seqDB search
MMRKKSFWLGMLTALMLVFTMAFSDSASAAQPAKNVEKDYIVGFKSGVKTASVKKDIIKE
SGGKVDKQFRIINAAKAKLDKEALEEVKNDPDVAYVEEDHVAHALAQTVPYGIPLIKADK
VQAQGYKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALD
NTTGVLGVAPNVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMK
QAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAEL
EVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATY
LGSSFYYGKGLINVEAAAQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggaaaaagagtttttggcttgggatgctgacggccttaatgctcgtgttcacg
atggccttcagcgattccgcgtctgctgctcagccggcgaaaaatgttgaaaaggattat
attgtcggatttaagtcgggagtgaaaaccgcatccgtcaaaaaggacatcatcaaagag
agcggcggaaaagtggacaagcagtttagaatcatcaacgcggcaaaagcgaagctagac
aaagaagcgcttgaggaagtcaaaaatgatccggatgtcgcttatgtggaagaggatcac
gtagctcatgctttggcgcaaaccgttccttacggcattcctctcattaaagcggacaaa
gtgcaggctcaaggctacaagggagcgaacgtaaaagtcgccgtcctggatacaggaatc
caagcttctcatccggacttgaacgtagtcggcggagcaagcttcgtagctggcgaagct
tataacaccgacggcaacggacacggcacgcatgttgccggtacagtagctgcgcttgac
aatacaacgggtgtattaggcgttgcgccgaacgtatccttgtacgcggttaaagtgctg
aattcaagcggaagcggatcttacagcggcattgtaagcggaatcgagtgggcgacgaca
aacggcatggatgttatcaacatgagccttggaggaccatcaggctcaacagcgatgaaa
caggcggttgacaatgcatatgcaagaggggttgtcgttgtggcggctgctgggaacagc
ggatcttcaggaaacacgaatacaatcggctatcctgcgaaatacgactctgtcatcgca
gttggcgcggtagactctaacagcaacagagcttcattttccagcgtcggagcagagctt
gaagtcatggctcctggcgcaggcgtgtacagcacttacccaaccagcacttatgcaaca
ttgaacggaacgtcaatggcttctcctcatgtagcgggagcagcagctttgatcttgtca
aaacatccgaacctttcagcttcacaagtccgcaaccgtctctccagtacggcgacttat
ttgggaagctccttctactatggaaaaggtctgatcaatgtcgaagctgccgctcaataa

DBGET integrated database retrieval system