KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi01174Help
Entry
BLi01174          CDS       T00200                                 

Gene name
asnO
Definition
asparagine synthase AsnO (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BLi01174 (asnO)
Enzymes [BR:bld01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BLi01174 (asnO)
Peptidases [BR:bld01002]
 Cysteine Peptidases
  Family C44
   BLi01174 (asnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1181048..1182889
Genome map
AA seq 613 aa AA seqDB search
MCGITGWVDFKKPLVREQSIMEKMTDTLSKRGPDDTNIWGKRHVLFGHKRLAVVDLEGGR
QPMTRTHQGYDYTICYNGELYNTEDLRKELRRRGHQFKSHSDTEVLLHSYMEWKEECIDR
LNGIFAFAVWDEKRDLLFAARDRLGVKPFFYTEQGSSFLFGSEIKAILAHPEVKAKVDRS
GLAEIFGLGPSRSPGSGVFKGVKEIRPGHAMIFSKDGLTVWRYWNVKSEKHTDSFDETVE
NVRSLFQDAVTRQLVSDVPVCTFLSGGVDSSAITATAAKHFEREGKAPLHTFSIDYEDNE
QYFTSSSFQPNADGPWIKKMSDAFGTVHHNCVISQEELAAYLEEAVLVRDLPGMADVDSS
LLWFCREIKKDFVVSLSGECADEIFGGYPWFHSAEDVKGFPWMRSMEERIGLLQDGWQKK
LNLSEYVKAKYEETVKETPLLEGETGAEKRRRELFYLNMLWFMTTLLDRKDRMSMGASLE
VRVPFADHRLVEYVWNIPWDVKMHGSREKGIFRKALEGILPDEVLYRKKSPYPKTHHPAY
TKAVIRWLESLLEQKDSALYAFLEKKKLERLIETEGASFQVPWYGQLMKGPQLIAHLAQI
HTWFESYRIDIEE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaataacggggtgggtcgattttaagaagccgcttgtccgagagcagtcaatc
atggagaagatgactgatacgctttcgaaaagaggacctgatgatacgaatatttgggga
aagcgccatgttttattcggacataaacgcttggcagttgtggatctggaaggcggcaga
cagccgatgacccgcacacatcaaggatatgattatacgatttgctataatggcgagctc
tataatacggaggatttgcgaaaagagcttaggcggcgggggcatcaattcaagagccac
tcagatacagaggttttgcttcattcatacatggaatggaaagaggaatgcatcgacagg
ctgaacggaatttttgcatttgcggtatgggatgaaaagcgggatcttctttttgcggca
cgcgaccggcttggtgttaaaccgttcttttacaccgaacagggctcatcatttttgttc
ggatctgaaatcaaagccatcctcgctcatcctgaagtgaaagcaaaggtagaccgttca
gggctggcagaaattttcggcctcggcccgtcacgatcgccggggagcggtgtttttaaa
ggagtaaaggagatccgcccggggcatgcgatgattttctcaaaagacggtttaacggtt
tggcgctactggaatgtgaaaagcgagaagcatacggacagctttgacgaaacggtggaa
aatgtgcggtcgctgtttcaggacgccgttacaaggcagcttgtgtctgatgtgccggta
tgtacgtttttatctggaggggtcgattcgagcgccattaccgcaacggccgccaagcat
ttcgagagagaagggaaggcgccccttcatacgttttcgatcgattatgaagacaatgag
caatattttacgtcaagctcatttcagccaaacgccgacggcccgtggattaaaaaaatg
tccgatgcattcggaacggttcatcacaattgcgtgatatcccaggaggagctggctgcc
tatttggaagaagccgtactggttcgggatttgccggggatggctgatgtcgattcttcc
ctgctatggttctgccgcgagattaaaaaagactttgtcgtgagcctttcaggggaatgc
gcggacgaaattttcggcggctatccttggttccattcggcagaagatgtgaaaggtttc
ccatggatgagatcaatggaagaacggatcggacttctgcaggacggctggcagaaaaag
ctgaacctcagcgaatatgtgaaggcaaaatatgaggaaacagttaaagaaacaccgctg
ctggaaggagaaacgggtgcggagaaacgaaggagagagctgttttacttaaatatgctc
tggtttatgacaacgctcttggatcgaaaagacagaatgagcatgggtgcgagcctcgag
gtcagggttccgtttgcagatcacaggcttgtcgagtatgtctggaatattccatgggat
gtcaaaatgcatggcagccgtgaaaaaggcatcttccgcaaggcgctggaaggcattttg
cctgatgaagtgctgtaccgcaaaaaaagcccatatccgaaaacgcaccacccggcctat
acgaaagccgtgatacgctggctggagtcattgctggagcaaaaagactcggcgctctat
gctttcttagaaaagaaaaaactggagcggctgattgagacggaaggtgcatcatttcaa
gttccgtggtacggacaattgatgaagggaccgcagctgatcgcccaccttgcccaaatc
catacttggtttgaaagttatcgaattgatatcgaggaataa

DBGET integrated database retrieval system