KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi01281Help
Entry
BLi01281          CDS       T00200                                 

Gene name
yngB
Definition
UTP--glucose-1-phosphate uridylyltransferase YngB (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BLi01281 (yngB)
   00052 Galactose metabolism
    BLi01281 (yngB)
   00500 Starch and sucrose metabolism
    BLi01281 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    BLi01281 (yngB)
Enzymes [BR:bld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BLi01281 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1286789..1287679)
Genome map
AA seq 296 aa AA seqDB search
MKVKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAVQSGIEDILIITGRNK
RSIEDHFDRSVELEQNLLAKGKNDVLKEIREIADMANIHYIRQKEPIGLGHAVLSAKHFI
GDEPFAVLLGDDIMVSETPALRQLLEVYEEYQTEVIGVQPVDPADVSKYGIIQTSAQKNK
VYQIDDLVEKPTVKDAPSNIAVMGRYVLRPSIFPVLEQTKRGAGNEIQLTDALREICREQ
SMYARKLKGSRFDIGDKLGSFKASTEIALMRDEMRPKLLAYLESVLKKEAQKGAWQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaaaaagcagtcatcccagcagccggattaggtacgagatttttgccggca
acaaaagcgcagccgaaagaaatgctgccgattgtcgataaaccggccatacaatatatc
gtggaagaagctgtccaatcaggcattgaagacatccttatcattacaggaagaaataag
cgttcgattgaagaccattttgaccgctctgtggaacttgagcaaaacctgctggccaaa
ggaaaaaacgatgtgttaaaagagatacgcgagatcgccgatatggcgaatattcattat
atccggcaaaaggagcccatcggcctcggacatgcagtgttatcggccaagcatttcatc
ggtgatgagccgtttgccgtcctcctcggcgacgatatcatggtgtcagaaacaccggcg
cttaggcagctgctcgaagtatatgaagaatatcagaccgaagtgatcggcgttcagccc
gtcgatccagcggacgtgagcaaatacggcatcattcagacatccgcgcaaaagaacaaa
gtgtatcaaatcgacgatcttgtagaaaagccgaccgtcaaagatgcgccttcaaatatc
gcggtcatgggccgctatgtgctgaggccttcgattttccctgtgctcgaacaaacgaag
cgcggcgcgggaaatgaaattcagctgactgacgcactaagggaaatctgccgggaacaa
agcatgtatgcgcgcaaattgaaaggaagccgctttgatatcggcgacaagctgggcagc
tttaaagcgagtacggaaatcgccctcatgcgggacgagatgcggccaaaactgctcgcc
tacctggagagcgtcttaaaaaaagaagcgcagaaaggagcatggcaatga

DBGET integrated database retrieval system