KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi01382Help
Entry
BLi01382          CDS       T00200                                 

Gene name
yesZ
Definition
beta-galactosidase YesZ (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BLi01382 (yesZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    BLi01382 (yesZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BLi01382 (yesZ)
Enzymes [BR:bld01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BLi01382 (yesZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1376273..1378270
Genome map
AA seq 665 aa AA seqDB search
MKMNGKLYHGACFYPELWDEDVLDEDIRMMERIGINVVRIGEFAWSRMEPEKGRIDVGFF
ADVIRKLRDNKIETVMCTPTATPPIWLTHGHPERMHVNEKGETMGHGSRQHACTNHPYFR
ERARLIIKHIAKEIGELPGLIGWQLDNEFKCHVAECICETCRTLWHKWLEDRYQTIDRLN
EAWGTGVWSETYQCFEQVPQPGPTPFLHNSSLRTMYQLFSMDKISEFAREQAEVIRAYSD
APITHNSSVMFGVDHEDLFKSLDFASFDTYASQENSQAFLFNCDLWRNIKKGRPFWIMET
SPSYSASLESYAAPHQNGYLKAEAVSSYALGGAAFCYWLWRQQRAGSEQPHGSVLSAWGE
PDVGYENVLEAERARREVEHIMLATAPLQAETAVVYSDRAKVFLKTEPHRGLHYRTLITE
FYDRLLKMGIHRDVILEGSPLDGYKLLFTPFIHYLPPAFIKKAEAFAQSGGIWIAGPLTG
GRTEHHTIHTDCGLGPLEKCSGVKTLFTFPMDERNSSGTAFGVKAPLSLWSAVFEAGGTK
AVGMIEKGPASGKAFITEHKCGKGKIVMLGSMPAGEAGDIMMKKLISHYAEEAGVEQKTD
VTPGTVVAPRKGADGLVWVVINMDGKGGAVTLDGNGTDLLSGRPVTGRVTLGPHDYRVIL
LSENK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaacggaaagctgtaccatggcgcttgcttttatcccgaattgtgggatgag
gatgtgctggatgaagatatcaggatgatggagcgaatcgggatcaatgttgtcagaatc
ggggagtttgcctggtcaaggatggagcctgaaaaaggaaggatcgatgtcggatttttt
gcagacgtcatccgaaagctccgcgacaacaaaattgaaacggtcatgtgcacgccgact
gcgacgccgccgatctggctgacccacgggcacccggaaagaatgcatgtgaatgaaaaa
ggggagacgatgggacacggttcgaggcagcatgcctgcacaaaccatccctatttcaga
gagcgggcccggctgatcatcaaacatatcgccaaagagatcggagaactgccgggattg
atcggatggcagcttgacaatgaattcaaatgccatgtcgcagaatgcatatgtgaaacg
tgccgcacattatggcacaaatggctggaagaccgctatcagacgattgaccgtctgaat
gaggcatggggtacgggcgtatggagcgaaacgtatcagtgcttcgagcaagtcccgcag
cccggaccgaccccgtttttgcataattcttctttaaggacaatgtatcagctgttttcg
atggacaagatttctgaatttgcgcgtgaacaggctgaggtgatcagagcatactccgat
gccccgatcacccataatagcagcgtcatgttcggcgttgatcatgaagaccttttcaag
agccttgattttgcctcgtttgatacgtacgccagccaggaaaacagtcaagcctttttg
tttaattgtgatttatggagaaacatcaaaaaaggacggccgttttggattatggagacg
agcccttcctacagcgcttcgcttgaaagctatgcggcgcctcatcaaaacggctatttg
aaagctgaagcggtttcttcttatgctcttggcggagccgcgttctgctattggctgtgg
cgccagcagagagccgggtctgaacagccgcacggatcagtgctcagcgcatggggggag
cctgatgtgggatatgaaaatgtgctcgaagccgagcgggcaagacgagaggttgaacac
atcatgctggctacggctcctttgcaggctgaaacagctgtcgtctattcggaccgtgcg
aaggtgtttttgaaaacggagcctcatcggggtcttcattacagaacgctgatcaccgag
ttttatgaccgattattaaagatgggcattcacagggatgtcattcttgaagggagcccg
ctggacggctacaaactgctgtttacgccgtttattcattatcttccccctgcttttatc
aaaaaagccgaagcatttgcacaaagcggcggcatttggattgcgggtccgctgacgggc
ggaagaacagagcaccatacgattcacactgattgcggattggggcctttagaaaaatgt
tctggtgttaaaacgctgtttacattcccgatggatgagcggaactcaagcggaacggcg
tttggcgtaaaggcgccgctgagcttgtggagcgctgtttttgaagccggcggcaccaag
gctgtcgggatgattgagaaaggcccggcgtcaggcaaagcgttcatcacggaacacaaa
tgcggaaaaggcaaaatcgtcatgctcgggtcgatgccggcaggcgaagcgggggacatc
atgatgaaaaagctgatcagccattatgccgaagaagcgggcgttgagcagaaaaccgat
gtcactcccggaacagtcgtcgcgccccggaaaggagcagacggtcttgtctgggtcgtg
atcaatatggacggcaaaggaggcgcagtgacacttgacggcaacggaaccgatctttta
tccggcaggcccgtaaccggacgcgtaacactcggcccgcacgactaccgcgtgattttg
ttatcagagaataaatga

DBGET integrated database retrieval system