KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi01412Help
Entry
BLi01412          CDS       T00200                                 

Gene name
proB1
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bld01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bld00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1408615..1409712
Genome map
AA seq 365 aa AA seqDB search
MKKQRIVIKIGSSSLTNSKGSIDEEKINDHVRAIAALKKEGHEVIFISSGAVAAGFLQLG
YPARPVTLKGKQAAAAVGQSLLMQTYIEHFADHDIKPAQILLTRNDFAKRERYRNAYATV
MELIERGLVPIINENDSVSVEELTFGDNDMLSALVSGLIHADKLIILTDINGLYDSNPAE
HPDARRFDYIPEITDELLGCAASAGSKVGTGGMKSKLLAAKTALSLGVNVFIGAGEGDDK
LIQILKGNGDGTYIGQSDLSSVNNHRQWIAFHSPVSGKITVDEGAELAITENGGSLLPAG
VTAISGDFPKGAVVEVYGPNGLAGKGQTLYSAAELEEVKGKRSDEFHHEEGIEVIHRNDW
VSIKE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaacaacggattgtcattaaaatcggaagcagttcattaaccaactcgaagggc
agcatcgatgaggagaagatcaatgaccatgttcgggcgatagctgctctgaaaaaagaa
ggccatgaagtcatcttcatttcgtcgggggctgtcgctgcgggatttttacagctcggc
tatcccgcaaggcctgtgacgctaaagggaaaacaggctgcagcggccgtcggccagagc
ttgttaatgcaaacatacatcgagcattttgcagaccacgatatcaagcctgcgcagatc
ttattgacgagaaacgattttgccaaacgggagcgctatcgaaatgcatatgcgaccgtt
atggaactgattgaacgggggcttgtcccgattattaatgaaaatgattcggtatctgtt
gaagaattgacgtttggggacaacgacatgctttccgcccttgtaagcggactgattcat
gccgacaaactcatcattttaacggatattaacggcctctatgactcgaatccggctgaa
catcccgatgcccgccgttttgattacattcccgaaattacggacgaacttttgggctgc
gccgcttccgccggatcaaaagtcgggacgggcgggatgaagtcgaagcttttggcggca
aaaaccgctctttcactcggcgtcaatgttttcataggcgccggagagggagatgataag
ctgatccagattttaaaaggaaacggggacggcacctatatcggccaatccgacctgtct
tccgtcaacaatcataggcagtggatcgcctttcattcacctgtttcagggaagattacc
gttgatgaaggggctgagctggcgattaccgaaaacggcgggagcctgctgccggccggc
gtaacagcgatatccggagattttccgaaaggggcggttgtcgaagtttacggaccgaac
ggcttggccgggaaaggccaaacgctgtactccgccgcagagcttgaagaggtaaaaggg
aagcgaagcgatgagttccatcatgaagaagggatagaagtcatccatcgaaatgattgg
gtaagcattaaagaataa

DBGET integrated database retrieval system