KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi01517Help
Entry
BLi01517          CDS       T00200                                 

Gene name
mtnD
Definition
acireductone dioxygenase MtnD (EC:1.13.11.54 1.13.11.53)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BLi01517 (mtnD)
Enzymes [BR:bld01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BLi01517 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BLi01517 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1492407..1492946
Genome map
AA seq 179 aa AA seqDB search
MATIRIHDEQNTSIENQEEVEQFLKRQEVIYEKWDITKLPAGLKEKYDLTDEEKQEILDV
FAAEIKDISERRGYKASDVISLSDQNPKLDELLKNFKQEHHHTDDEVRFIVSGHGIFAIE
GKDGTFFDVLLNPGDLISVPENTRHYFTLQEDRKVVAVRIFVTTEGWVPIYEKENVNQS
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaattcggatccatgatgaacaaaacacgagcattgaaaaccaggaagaagta
gaacaatttctaaagcggcaggaggtcatttatgaaaagtgggatatcacaaaactgccg
gccggtttaaaggaaaaatacgatttgaccgatgaagagaaacaggagattttagacgtc
tttgccgctgaaatcaaagacatttcagaacgccgcggctataaagcgagcgatgtcatc
tcgctttccgaccaaaatccgaaactcgatgagcttttgaaaaacttcaaacaggagcat
catcatacagacgatgaagtcaggtttatcgtcagcggccacggcatctttgcgatagaa
ggaaaagacggcacattttttgatgtccttttaaatccgggggatttgatctctgttcct
gaaaacacccgccattatttcacgcttcaggaagaccggaaagtcgtggctgtcagaatc
tttgtgacgacagagggctgggtgccgatttatgaaaaagagaatgtgaaccagtcataa

DBGET integrated database retrieval system