KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi01517Help
Entry
BLi01517          CDS       T00200                                 

Gene name
mtnD
Definition
acireductone dioxygenase MtnD (EC:1.13.11.54 1.13.11.53)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bld00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1492407..1492946
Genome map
AA seq 179 aa AA seqDB search
MATIRIHDEQNTSIENQEEVEQFLKRQEVIYEKWDITKLPAGLKEKYDLTDEEKQEILDV
FAAEIKDISERRGYKASDVISLSDQNPKLDELLKNFKQEHHHTDDEVRFIVSGHGIFAIE
GKDGTFFDVLLNPGDLISVPENTRHYFTLQEDRKVVAVRIFVTTEGWVPIYEKENVNQS
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaattcggatccatgatgaacaaaacacgagcattgaaaaccaggaagaagta
gaacaatttctaaagcggcaggaggtcatttatgaaaagtgggatatcacaaaactgccg
gccggtttaaaggaaaaatacgatttgaccgatgaagagaaacaggagattttagacgtc
tttgccgctgaaatcaaagacatttcagaacgccgcggctataaagcgagcgatgtcatc
tcgctttccgaccaaaatccgaaactcgatgagcttttgaaaaacttcaaacaggagcat
catcatacagacgatgaagtcaggtttatcgtcagcggccacggcatctttgcgatagaa
ggaaaagacggcacattttttgatgtccttttaaatccgggggatttgatctctgttcct
gaaaacacccgccattatttcacgcttcaggaagaccggaaagtcgtggctgtcagaatc
tttgtgacgacagagggctgggtgccgatttatgaaaaagagaatgtgaaccagtcataa

DBGET integrated database retrieval system