KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi01863Help
Entry
BLi01863          CDS       T00200                                 

Gene name
cheB
Definition
chemotaxis-specific protein-glutamate methyltransferase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bld02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bld02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1816933..1818006
Genome map
AA seq 357 aa AA seqDB search
MIRVLVVDDSAFMRNMITKFLTSNHEIAVAGTARNGEEALQKIKELRPDVITLDIEMPVM
NGKETLKRIMASDPLPVVMVSSLTQQGADITIECLELGAIDFVAKPSGSISIDLYKVRDM
LIEKVLTAGRVKLKGRQVPISKPAIETAKQPIVGGSDSVRFRAGKQLICIGTSTGGPRAL
QRVLPKLPKTLKAPVFIVQHMPKGFTASLANRLNHLSEVTVKEAENGERAKDGWVYIAPG
GKNMAVGLEKGELVITLDDRDTESRHKPSVDYLFQSLASLREFEKIAVIMTGMGSDGTEG
VKGLLKHGSGTVIAEAAESSVVFGMPKSVINNGLANDIKHVDEIAAAIMTYMKKERA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtgttcttgtcgttgacgactctgcttttatgagaaacatgatcaccaagttt
ttaacatccaatcacgagattgctgtagcaggaacggcaagaaacggcgaggaagcgctc
caaaaaatcaaggagctccgtccggatgtgatcacattggatattgaaatgcctgtgatg
aacggaaaagaaacgttgaaaaggattatggcgagcgatccgcttccggttgtcatggta
tcgagcctgacgcagcagggagcagatatcacgatcgaatgtctggagcttggggcgatc
gatttcgtcgcgaagccgtcgggttcgatttcaatagatttatataaagtaagagacatg
ctgattgagaaggttttgacagcaggacgggtgaaactgaaaggccggcaagttccgatc
tcaaagcccgccatcgagacggcgaagcagccgattgtgggcggcagcgattcagtccgc
tttcgggctggaaaacagctcatctgcatcggtacatcgacaggggggccgagggcgctg
caaagagtgcttcccaagcttcccaaaacgttgaaggcgcctgtttttatcgttcagcac
atgccaaagggctttacggcctcattagcgaacaggctgaaccacctctcagaagtaacc
gtgaaggaggctgaaaacggtgagagagcgaaagacggctgggtttacattgcacccgga
ggaaaaaacatggcggtcggccttgaaaagggcgaattggtgatcacgctcgatgaccgc
gacacagaaagccgccacaagccttctgttgactacttgtttcaatccctggcctcactt
cgggagtttgaaaaaatcgccgtcattatgacggggatgggaagcgacggaacagaaggc
gtaaaaggccttttgaaacatgggagcggaacggtgatcgccgaagcagccgagtcgtcc
gtcgttttcggaatgccgaaatcggtcattaacaacgggcttgcaaacgacatcaagcat
gttgatgagattgccgcagccattatgacgtatatgaaaaaagagagggcgtga

DBGET integrated database retrieval system