KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02138Help
Entry
BLi02138          CDS       T00200                                 

Gene name
acsA1
Definition
(GenBank) acetyl-coenzyme A ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00010  Glycolysis / Gluconeogenesis
bld00620  Pyruvate metabolism
bld00640  Propanoate metabolism
bld00680  Methane metabolism
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01120  Microbial metabolism in diverse environments
bld01130  Biosynthesis of antibiotics
bld01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLi02138 (acsA1)
   00620 Pyruvate metabolism
    BLi02138 (acsA1)
   00640 Propanoate metabolism
    BLi02138 (acsA1)
  Energy metabolism
   00680 Methane metabolism
    BLi02138 (acsA1)
Enzymes [BR:bld01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BLi02138 (acsA1)
Lipid biosynthesis proteins [BR:bld01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BLi02138 (acsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AAU41025
Position
complement(2085585..2087537)
Genome map
AA seq 650 aa AA seqDB search
MGEKAVWQPDPEFVKTTRLFQWMTALGFSDYDDFLKASTNDIAWFWEEAEKALGISWYKR
YSQTLNLDKGIKWPQWFTGGRLNAVYNAVEKWARRPDTAGRTALIWESEDGKTEQITYSS
LHQQVARAAAGFKKQGISKGDVIAIYMPMIPETVIAMLAAAKIGAVFSPVFSGYGAHAAA
ARLTAAGAKILVTADAFLRRGKKVCMKKEADKAADRSPTVQKVVVCKLHGGDQDWNYKRD
IDWNELMKNEPMQNTEEMDSSDPLMLLYTSGTTGQSKGAVHTHAGFPLKAAFDAGFGMDV
KQGDTFFWFTDMGWMMGPFLIFGGLINGAAVLLFDGAPDYPAPDRLWELVSRHRVTHLGV
SPTLIRSLMQHGEDFLYQYNLNSLKAIGSTGEPWNYEPWMWLFRHVGKERIPIFNYSGGT
EISGGILGNVLLRPITPMTFNSPLPGMAANVFNEKGEEVVNEVGELVLTKPWVGMTNGFW
KEPSRYEEAYWSRWTDVWVHGDWAKRDENGYWTISGRSDDVINAAGKRIGPAEIESVLVG
HPAVAEAGVIGVPDKLKGQAAVCFVVLRQSEKPSEELKDDLLNLASDAIGKAVKPKAVYF
VSGLPKTRNAKVMRRLIRAAYMNEPAGDLSTLENRETYDEIAGLSVRKNL
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaaaaagcggtttggcagcctgatccggaatttgtaaaaacaacccggctgttt
caatggatgacagccctcggtttttccgactatgatgattttttgaaagcaagtacaaac
gatatcgcctggttctgggaagaggccgaaaaagcgctcgggatcagctggtacaagcgg
tacagccaaacattgaatctcgacaaaggcataaaatggccgcaatggtttaccggcggc
cgcttaaatgccgtttacaacgccgtggaaaaatgggcccgccggcctgatacggccggc
aggacggcactcatctgggaaagtgaagacggaaaaacagaacagatcacctattcttct
ttacaccaacaagtcgcccgtgcggcggcaggctttaaaaagcaaggcatctcaaaaggg
gatgtcattgcgatttacatgccgatgatccccgaaacggtcatcgccatgctggccgcc
gctaaaatcggagcggtattctcaccggttttttcaggctacggcgcccatgcagcagcg
gcgagacttaccgctgccggagcgaaaatccttgtcacagcagatgcctttttgcgaagg
ggaaagaaggtctgcatgaagaaagaagctgacaaagccgcggaccgttcccccactgtt
caaaaagtcgtcgtctgcaagcttcacggcggcgatcaagattggaattataagagagat
atcgactggaatgaattgatgaaaaacgagcccatgcaaaacaccgaagaaatggacagt
tcagatccgctcatgctgctatacacatcagggacgacaggacagtcgaagggagcggtt
catacccatgccggttttccgctgaaagctgcatttgatgcgggattcgggatggatgtc
aaacaaggggacacatttttctggtttacagacatgggctggatgatggggccgttttta
atattcgggggcctcataaacggagcggctgttttgctgtttgacggagcaccggactac
ccggccccggatcggctgtgggagcttgtcagcagacaccgggtgacgcatctcggcgtc
tctccgacgctcattcgctcgctgatgcagcacggcgaagattttctctatcaatacaat
ctgaacagtctgaaggcaatcggctcaacgggcgaaccatggaattatgagccgtggatg
tggctgttccgccatgttggaaaagaacggattcctatatttaattattcaggaggaaca
gagatctcaggcggaattttaggcaatgtgctcctgcggccgatcacgccgatgacgttt
aattcgcctcttcccggcatggcggccaatgtcttcaatgaaaaaggagaggaagtcgtc
aatgaagtcggagagcttgtcctgacaaagccctgggtcggcatgacgaacggtttttgg
aaggagccgtcaagatacgaagaagcatattggagccgctggaccgacgtctgggtgcac
ggcgattgggcaaaacgggatgaaaacggctactggacgatcagcggacgctctgatgat
gtgatcaatgctgccgggaaaaggatcggccccgccgaaatagagtccgttctggtcggc
catccagcggtggcggaagcaggcgtcatcggcgttccggataagctcaaaggccaggct
gccgtctgcttcgtcgtcctcagacagtcggaaaagccgtcggaagaattaaaagatgat
ttgctgaaccttgcatctgatgcgatcggtaaagcggtcaagcccaaagcggtttatttt
gtcagcggtttgccgaagacgagaaatgcaaaagtgatgagacggctgatcagagctgcc
tatatgaacgagcccgcaggcgatttgtcaactttggaaaaccgcgaaacatatgatgaa
attgccggtctttcagtgcgaaaaaatctgtag

DBGET integrated database retrieval system