KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02146Help
Entry
BLi02146          CDS       T00200                                 

Gene name
yrkL
Definition
NAD(P)H oxidoreductase YrkL (EC:1.6.99.-)
Orthology
K00358  
[EC:1.6.99.-]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Brite
Enzymes [BR:bld01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With other acceptors
    1.6.99.-  
     BLi02146 (yrkL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2095522..2096082
Genome map
AA seq 186 aa AA seqDB search
MKTLVIVAHPNLETSVVHKRWVEELKKYPEKYTVHELSDVYPDGNIDAEKEQKLVESHGN
LVLQFPIYWFNCPPLLKKWLDDVLAYGWAYGSNGGDRLNNRKVALGVSAGIKEEDYRENG
RYRYTLEQILVPFETTFRYCRADYRSFFAFYGKEKEPGGNEEEENEPGAGELEKSARDYL
HFIDHM
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacgctagttatcgttgcacacccaaatttagaaacatcagtggttcataagcgc
tgggtagaggaactcaaaaaatatccggaaaagtatacggttcacgaattgtccgacgtt
tacccggatggaaacatagacgcggaaaaagaacaaaaattggtggaatcgcacggcaat
cttgttttgcaattccctatctattggtttaactgtccgcctcttcttaaaaaatggctt
gatgatgtattagcttacggctgggcttatggttcaaatggaggagatcgattaaacaat
cgtaaagtggcattaggtgtatccgccggaattaaagaggaagattatcgtgaaaacgga
aggtaccggtatacgcttgaacaaatattagttccatttgaaacgacattccggtattgc
cgcgcagattatcgttcattttttgcattttacggcaaggaaaaagagcctggcggaaac
gaggaagaagaaaatgagccgggagcaggagaattggagaaaagcgcacgagattatttg
cattttattgatcatatgtag

DBGET integrated database retrieval system