KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02259Help
Entry
BLi02259          CDS       T00200                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bld01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bld00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bld00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2216050..2217330)
Genome map
AA seq 426 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEFLLELETDKVNVELTAEQSGVLQEVLK
DSGDTVQVGEIIGTISEGEGEGGKSTAPQADAQESAGASEEKAASSEKTAEPREGASDEA
DTAKTRTIASPAARKLAREKGIDLSEIPTGDPLGRVRKQDVESYQKNEQPPKAQPEPKRA
TQAPAAKQTEDAGKPVERQRMSRRRQTIAKRLVEVQHTAAMLTTFNEVDMTAVMNLRKRR
KDQFLEQHDVKLGFMSFFTKAVVAALKKYPLLNAEIQGDELVIKKFYDIGIAVAAPDGLV
VPVVRDADRKTFADIERDIGELAKKARNNKLSLNELQGGSFTITNGGTFGSLLSTPILNS
PQVGILGMHKIQLRPVAIDEERFENRPMMYIALSYDHRIVDGKEAVGFLVTIKNLLEDPE
QLLLEG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaagtacctgaattagcggaatcaatttcagaaggaacgatagcccaa
tggctgaaacaaccgggagattatgtagagcaaggggaattcctgcttgagctggagact
gataaagtcaacgtggaattgacggcagagcagtccggcgttcttcaggaagtgctgaaa
gattccggtgacacggttcaggtcggcgaaataatcggaacgatttcagaaggcgaagga
gaaggaggcaaatcaacggctccgcaagctgacgctcaagaaagcgccggcgcttcggaa
gagaaagcagcctcgtctgaaaagacagccgaacctcgcgaaggtgcgagcgatgaggcg
gatacagccaaaacaagaactatcgcttctccggctgcccgaaagctcgcccgggaaaaa
ggcatcgatttatcggaaatccctaccggtgatccgctcggaagggtcagaaaacaggat
gttgaatcttatcaaaagaacgagcagccgccaaaagctcagcctgaaccaaaacgcgca
acacaggcgccggccgctaaacaaaccgaagatgctggtaaacctgtagagcgtcaaaga
atgtcccgccggagacagacgatcgccaaacgcctcgttgaagttcagcacaccgccgct
atgctgacgacattcaacgaagtggacatgacggcggtcatgaacttaaggaagcgccga
aaagatcaattcctggagcagcatgacgtgaagctcggattcatgtcattctttacaaaa
gctgttgtcgccgcgctgaaaaaatatccgctcctcaacgcggaaattcaaggcgacgag
cttgtgatcaaaaaattctatgacatcggaatcgctgttgctgcgccggatggcctcgtc
gtaccggtcgtgcgcgatgcggaccgcaaaacctttgccgatattgaaagggatatcgga
gagcttgcgaagaaagcgagaaacaacaaattgtcgctcaacgagcttcaaggcgggtcc
tttacgatcacaaacggaggaacgttcggttcattgttatcgactccgattttgaacagc
ccgcaagttggtattttgggcatgcacaaaatccagctgcgtcctgtagcaattgatgaa
gagcgctttgaaaaccgcccgatgatgtacattgcattatcgtatgaccaccggatcgtc
gacggaaaagaagcggtcggcttcctggttacgattaaaaatctgcttgaagatcctgaa
cagcttctgttggaaggttaa

DBGET integrated database retrieval system