KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02259Help
Entry
BLi02259          CDS       T00200                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLi02259 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLi02259 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BLi02259 (odhB)
Enzymes [BR:bld01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BLi02259 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2216050..2217330)
Genome map
AA seq 426 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEFLLELETDKVNVELTAEQSGVLQEVLK
DSGDTVQVGEIIGTISEGEGEGGKSTAPQADAQESAGASEEKAASSEKTAEPREGASDEA
DTAKTRTIASPAARKLAREKGIDLSEIPTGDPLGRVRKQDVESYQKNEQPPKAQPEPKRA
TQAPAAKQTEDAGKPVERQRMSRRRQTIAKRLVEVQHTAAMLTTFNEVDMTAVMNLRKRR
KDQFLEQHDVKLGFMSFFTKAVVAALKKYPLLNAEIQGDELVIKKFYDIGIAVAAPDGLV
VPVVRDADRKTFADIERDIGELAKKARNNKLSLNELQGGSFTITNGGTFGSLLSTPILNS
PQVGILGMHKIQLRPVAIDEERFENRPMMYIALSYDHRIVDGKEAVGFLVTIKNLLEDPE
QLLLEG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaagtacctgaattagcggaatcaatttcagaaggaacgatagcccaa
tggctgaaacaaccgggagattatgtagagcaaggggaattcctgcttgagctggagact
gataaagtcaacgtggaattgacggcagagcagtccggcgttcttcaggaagtgctgaaa
gattccggtgacacggttcaggtcggcgaaataatcggaacgatttcagaaggcgaagga
gaaggaggcaaatcaacggctccgcaagctgacgctcaagaaagcgccggcgcttcggaa
gagaaagcagcctcgtctgaaaagacagccgaacctcgcgaaggtgcgagcgatgaggcg
gatacagccaaaacaagaactatcgcttctccggctgcccgaaagctcgcccgggaaaaa
ggcatcgatttatcggaaatccctaccggtgatccgctcggaagggtcagaaaacaggat
gttgaatcttatcaaaagaacgagcagccgccaaaagctcagcctgaaccaaaacgcgca
acacaggcgccggccgctaaacaaaccgaagatgctggtaaacctgtagagcgtcaaaga
atgtcccgccggagacagacgatcgccaaacgcctcgttgaagttcagcacaccgccgct
atgctgacgacattcaacgaagtggacatgacggcggtcatgaacttaaggaagcgccga
aaagatcaattcctggagcagcatgacgtgaagctcggattcatgtcattctttacaaaa
gctgttgtcgccgcgctgaaaaaatatccgctcctcaacgcggaaattcaaggcgacgag
cttgtgatcaaaaaattctatgacatcggaatcgctgttgctgcgccggatggcctcgtc
gtaccggtcgtgcgcgatgcggaccgcaaaacctttgccgatattgaaagggatatcgga
gagcttgcgaagaaagcgagaaacaacaaattgtcgctcaacgagcttcaaggcgggtcc
tttacgatcacaaacggaggaacgttcggttcattgttatcgactccgattttgaacagc
ccgcaagttggtattttgggcatgcacaaaatccagctgcgtcctgtagcaattgatgaa
gagcgctttgaaaaccgcccgatgatgtacattgcattatcgtatgaccaccggatcgtc
gacggaaaagaagcggtcggcttcctggttacgattaaaaatctgcttgaagatcctgaa
cagcttctgttggaaggttaa

DBGET integrated database retrieval system