KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02259Help
Entry
BLi02259          CDS       T00200                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component OdhB
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00020  Citrate cycle (TCA cycle)
bld00310  Lysine degradation
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01120  Microbial metabolism in diverse environments
bld01130  Biosynthesis of antibiotics
bld01200  Carbon metabolism
Module
bld_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bld_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLi02259 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BLi02259 (odhB)
Enzymes [BR:bld01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BLi02259 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RNase_T
Motif
Other DBs
NCBI-ProteinID: AAU41139
Position
complement(2216050..2217330)
Genome map
AA seq 426 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEFLLELETDKVNVELTAEQSGVLQEVLK
DSGDTVQVGEIIGTISEGEGEGGKSTAPQADAQESAGASEEKAASSEKTAEPREGASDEA
DTAKTRTIASPAARKLAREKGIDLSEIPTGDPLGRVRKQDVESYQKNEQPPKAQPEPKRA
TQAPAAKQTEDAGKPVERQRMSRRRQTIAKRLVEVQHTAAMLTTFNEVDMTAVMNLRKRR
KDQFLEQHDVKLGFMSFFTKAVVAALKKYPLLNAEIQGDELVIKKFYDIGIAVAAPDGLV
VPVVRDADRKTFADIERDIGELAKKARNNKLSLNELQGGSFTITNGGTFGSLLSTPILNS
PQVGILGMHKIQLRPVAIDEERFENRPMMYIALSYDHRIVDGKEAVGFLVTIKNLLEDPE
QLLLEG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaagtacctgaattagcggaatcaatttcagaaggaacgatagcccaa
tggctgaaacaaccgggagattatgtagagcaaggggaattcctgcttgagctggagact
gataaagtcaacgtggaattgacggcagagcagtccggcgttcttcaggaagtgctgaaa
gattccggtgacacggttcaggtcggcgaaataatcggaacgatttcagaaggcgaagga
gaaggaggcaaatcaacggctccgcaagctgacgctcaagaaagcgccggcgcttcggaa
gagaaagcagcctcgtctgaaaagacagccgaacctcgcgaaggtgcgagcgatgaggcg
gatacagccaaaacaagaactatcgcttctccggctgcccgaaagctcgcccgggaaaaa
ggcatcgatttatcggaaatccctaccggtgatccgctcggaagggtcagaaaacaggat
gttgaatcttatcaaaagaacgagcagccgccaaaagctcagcctgaaccaaaacgcgca
acacaggcgccggccgctaaacaaaccgaagatgctggtaaacctgtagagcgtcaaaga
atgtcccgccggagacagacgatcgccaaacgcctcgttgaagttcagcacaccgccgct
atgctgacgacattcaacgaagtggacatgacggcggtcatgaacttaaggaagcgccga
aaagatcaattcctggagcagcatgacgtgaagctcggattcatgtcattctttacaaaa
gctgttgtcgccgcgctgaaaaaatatccgctcctcaacgcggaaattcaaggcgacgag
cttgtgatcaaaaaattctatgacatcggaatcgctgttgctgcgccggatggcctcgtc
gtaccggtcgtgcgcgatgcggaccgcaaaacctttgccgatattgaaagggatatcgga
gagcttgcgaagaaagcgagaaacaacaaattgtcgctcaacgagcttcaaggcgggtcc
tttacgatcacaaacggaggaacgttcggttcattgttatcgactccgattttgaacagc
ccgcaagttggtattttgggcatgcacaaaatccagctgcgtcctgtagcaattgatgaa
gagcgctttgaaaaccgcccgatgatgtacattgcattatcgtatgaccaccggatcgtc
gacggaaaagaagcggtcggcttcctggttacgattaaaaatctgcttgaagatcctgaa
cagcttctgttggaaggttaa

DBGET integrated database retrieval system