KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02399Help
Entry
BLi02399          CDS       T00200                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit TrpB
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00260  Glycine, serine and threonine metabolism
bld00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01130  Biosynthesis of antibiotics
bld01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLi02399 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLi02399 (trpB)
Enzymes [BR:bld01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLi02399 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: AAU41279
UniProt: Q65I35
Position
complement(2342968..2344194)
Genome map
AA seq 408 aa AA seqDB search
MYSYPNEQGRFGDFGGKFVPETLMQPLEEIEKAFLELKDDPSFQKDYQKLLNDYSGRPTA
LTFADQLTKQLGGAKIYLKREDLNHTGAHKINNALGQALLAKKMGKTKLIAETGAGQHGV
AAATVAAKFGLSCIVFMGEEDVARQSLNVFRMKLLGAEVVPVSSGNGTLKDATNEAIRYW
VQHCQDHFYMIGSVVGPHPYPYIVREFQRMIGEEAKAQFYQLEQSLPDKVVACVGGGSNA
IGMFSAFIEETVELIGVEAAGKGVDTPLHAATITKGTKGVIHGSLTYLIQDEYGQIIEPY
SISAGLDYPGVGPEHAHLHQTGRVTYESVTDDEAVSALRLLTETEGILPAIESAHALAKA
FEIAKELPREKSVLVCLSGRGDKDVHTLMKVLEEEVNQDVQSEKTAVR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtattcatatccgaatgaacaaggcaggtttggtgattttggcgggaaattcgtcccg
gaaacactcatgcagcctttggaagaaatcgaaaaagcgtttcttgaactgaaagacgac
ccttcatttcaaaaggattatcaaaagcttttaaatgactactcaggcaggccgacggct
ttgacgttcgcagaccagctcactaagcagctgggcggagcgaagatttacttaaaaaga
gaagatttaaaccatacaggcgcccacaaaatcaacaatgccctcggccaggcgctcctg
gccaagaaaatgggaaaaacaaagctcattgctgaaaccggtgcaggccagcacggtgtg
gcggcggcgactgtcgccgcgaagttcggcttatcatgcatcgtcttcatgggggaggaa
gatgttgccagacaatcgctgaacgtgttccggatgaagctcttgggagcggaggtcgtc
ccggtgtcaagcggaaacgggacattaaaagatgctacaaacgaagcgatccgctactgg
gttcagcattgccaggaccatttttacatgatcggttccgtcgtcgggccgcatccgtat
ccttatatcgtccgcgaatttcaacggatgatcggcgaagaggcgaaagcgcagttttat
caattggagcaaagcctccccgataaagttgtcgcctgtgtcggaggcggaagcaatgcg
atcgggatgttcagcgcgttcattgaagaaactgttgaactgatcggagtcgaagctgcg
ggaaaaggtgttgacacacctcttcatgcggccacgatcacaaagggtacaaaaggcgtc
atccacggttctttgacctacttgattcaagacgagtacggacagatcatcgagccttat
tccatctcagccggacttgattatccgggagtcggccccgagcacgcccatcttcatcaa
acagggcgcgtcacgtatgaatctgtcacagatgatgaagcggtctcggcattaaggctg
ctgacagagactgagggcattttgccggctattgaatccgcccatgcattggcaaaagca
tttgaaatcgctaaagaactgccgagagagaaaagcgttctcgtctgcctttcaggcagg
ggagacaaagacgtccataccttgatgaaggtgttggaagaagaggtgaatcaagatgtt
caatctgaaaaaacagccgtccgataa

DBGET integrated database retrieval system