KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02401Help
Entry
BLi02401          CDS       T00200                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01130  Biosynthesis of antibiotics
bld01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLi02401 (trpC)
Enzymes [BR:bld01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BLi02401 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AAU41281
UniProt: Q65I33
Position
complement(2344831..2345589)
Genome map
AA seq 252 aa AA seqDB search
MLNQIIDRKREDILKIKLSEDLKLPKRSFKKALLSPNRFVALIAEVKKASPSKGVIQEGF
EPVKIAKQYEQAKADCLSVLTDTPFFQGKNSYLSDVKRSVSLPVLRKDFIIDSIQVEEAD
RIGADAILLIGEALEPQKLFELYQQAVEKGMDVLVEVHGEETLEGILNVFTPEIIGVNNR
NLKNFETTVGQTERMAKLVPPGTVLISESGIGKSEDLTFVKTCGAQAVLVGESLMRETSQ
LKAVYALFGEDG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatcaaattattgatagaaaacgagaagacatcctaaagatcaagctgtcggaa
gatttaaaactgccaaagcggtcatttaaaaaagcgctcctttctccgaaccggtttgtc
gctttaattgcggaggtgaaaaaagcttctccgtcaaaaggcgtgattcaggagggtttt
gagcccgtcaagatcgcaaaacaatacgaacaggctaaagccgattgtttgtctgttctg
acagatacacctttttttcaagggaagaacagttatttgtcagatgtgaaacgctcggtt
tccctgcctgtgctgcgcaaggattttatcattgattccattcaggttgaagaagcggac
cgcatcggagcggatgcgatcctgctgatcggtgaagcgcttgaaccgcaaaagctgttt
gaactctatcagcaagccgttgaaaaaggcatggatgtgctcgtcgaagtacatggcgaa
gagacgcttgagggcattttaaatgtctttacacccgaaatcatcggcgtaaacaatcga
aatctaaaaaactttgaaacgaccgtcggacaaacggagcgaatggcgaaactcgttccg
ccggggaccgttctcatcagcgaaagcggcatcggaaaatcggaagacctgacttttgta
aaaacgtgcggagcccaagccgtgcttgtcggcgaatcgctgatgagagagacgtcacag
ctgaaggctgtctatgcgttattcggagaggacggctga

DBGET integrated database retrieval system