KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02560Help
Entry
BLi02560          CDS       T00200                                 

Gene name
gmuD1
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLi02560 (gmuD1)
Enzymes [BR:bld01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BLi02560 (gmuD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2479373..2480788)
Genome map
AA seq 471 aa AA seqDB search
MSKTEPQLEQIQYRFPNGFWWGSAASATQTEGAAAEGGKGKNIWDHWYEKEPNRFFDGVG
PEKTSRFYETYREDIQLMKELGHHSFRFSISWARLFPDGKGRLNKEGAAFYNRVIDELLA
AGIEPFVNLYHFDMPLALQQIGGWENRQVVDHFASYAETCFRLYGDRVKKWFTHNEPIVP
AEGGYLYDFHYPNIVDFQKAVQVAYHEILSNAKAVEAYRRLGGDGKIGIILNLTPSYPRS
QHPADVRASEIADAFFNRSFLDPAVKGEFPQLLTDILKEEGYLPVMEEGDLELIKNHTVD
LLGINYYQPRRVKAKEHLPHPDAPFMPERFFDHYEMPGRKMNRHRGWEIYEKGIYDILIN
VKENYGNIECFISENGMGVEGEERFRGEDGMIRDDYRISFIKEHLKWVHRAIQEGANVKG
YHLWTFMDNWSWTNAYKNRYGFVSVNLDKNGERTIKKSGYWFKKVAENNGF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaacagaaccgcagctagaacaaattcaataccgttttccaaatggcttctgg
tgggggtcggcggcttccgccactcagactgaaggagcggcggccgaaggaggcaaagga
aagaacatttgggatcactggtacgaaaaagagccaaaccgattttttgacggagtaggc
cctgagaagacttcgcgtttttacgagacttacagagaagatattcagctgatgaaagag
cttggccaccactcttttcgtttctccatttcgtgggctcgtctgtttcctgatggaaaa
gggcggctgaacaaagaaggagctgccttttataaccgagtcatcgatgaactgcttgcg
gctggcatcgagccttttgtcaacctttatcattttgacatgccgcttgcgctccagcaa
atcggcggatgggaaaacaggcaagtcgtcgatcactttgcttcatacgcggaaacgtgc
ttcaggctgtacggggaccgagtgaaaaaatggtttacccacaatgagccgatcgttcct
gcagaaggcggctatctatacgattttcactatccgaacatcgtcgactttcaaaaagcc
gtccaggtcgcataccatgaaattctttcaaacgctaaagctgtcgaagcttatcgcaga
ctcgggggcgacggcaaaatcggcatcattttaaatttaacgccgtcctacccgcgaagc
cagcatccggcagatgtaagagcatctgaaatagccgacgctttctttaaccgatcgttt
cttgatcccgccgttaagggtgagtttccgcagcttttaacagatatattaaaagaagaa
ggctatttgcctgtcatggaagaaggagacttggagctgatcaaaaatcacactgtcgat
ctgctcggcatcaattattatcagccgagacgggtgaaagcgaaggagcacctgcctcat
ccggacgcgccttttatgccggaacggttttttgaccattatgaaatgcccggacgaaaa
atgaaccgccaccgcggctgggagatatatgaaaaaggaatctatgatattttaatcaat
gtcaaagaaaactacggaaatattgaatgctttatttctgaaaatgggatgggcgttgaa
ggagaagaacgtttccgcggcgaagacggcatgatccgcgatgactacagaatttcgttt
ataaaagaacacttaaaatgggtgcacagagccattcaggaaggagcgaatgtcaaaggc
tatcatctttggaccttcatggacaactggtcatggacgaacgcctataaaaaccgctac
ggttttgtatctgtcaaccttgacaaaaacggcgaacgaacgattaaaaaaagcggatac
tggtttaagaaagttgccgagaacaacggtttttaa

DBGET integrated database retrieval system