KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02565Help
Entry
BLi02565          CDS       T00200                                 

Gene name
phoB
Definition
(GenBank) alkaline phosphatase PhoB
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Aminobenzoate degradation
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BLi02565 (phoB)
   00790 Folate biosynthesis
    BLi02565 (phoB)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BLi02565 (phoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BLi02565 (phoB)
Enzymes [BR:bld01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BLi02565 (phoB)
Exosome [BR:bld04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BLi02565 (phoB)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bld00537]
 Enzymes
  BLi02565 (phoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2482956..2484617)
Genome map
AA seq 553 aa AA seqDB search
MGFLRNRIVGITLAGAVALGSAGTGSAAMETAKKKEEPKVKNVIMMVMDGTSSSATTLAR
WYKGEPLAMDQIVSGGVRTYSAESAITDSAPAATAMATGRKSNSSYIGVLPSKVNTPGVE
KVREKDHYRPVANVLEGAKQKGKATGIIATSEIQHATPAGYSGHHKDRNNFEVLGEQQVY
QNMDVVLGGGKESLQPGTKDKSRKDGEDLVKVLKDKKYDFVETKDQLLKSKSKKIWGAFS
QRDLAYDMDRRATHPEQPTIAEMTKKSIQTLSKDKDGFFLFVEGSKPDWAAHQNDPIGMI
SDVLAFDNAVKEALDFAKKDKHTMVIAVSDHGNSGISIGNSNTTKGYDTTPVSAYVDPLK
KAKMTVEGATGKLKDDLSNIEEAAKLYGLDDLTPAEKEQLKSVKNKKEAASLFTKLLSNR
ANIGFTTGGHTGEDVFLYSYGPEKPQGLVENTDIAKTMAKAMGFNLDKLTNELFIEAKQA
FKKAGASVTIDQKDPANPVLVAARKKAKAEMPVNKNIIRINGKEYELDSVIVESNGSFYV
PKEAVQLFKKYAR
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcttacgcaacagaatcgtcggcattacactggcaggcgcagtcgctttagga
tcggcgggaacaggcagtgcggcaatggaaacagcgaaaaaaaaagaagagccgaaggtc
aaaaacgtgatcatgatggtcatggatgggacaagctcttctgcaacaactttggcacgc
tggtataaaggcgaaccgctcgcaatggaccagatcgtcagcggcggtgtccggacgtat
tcggcagaatcggcgatcactgattctgcacctgcagcaactgcgatggcaacgggacga
aaatcaaattcttcctatatcggtgtgctgccttcaaaagtgaatacaccaggagtcgag
aaggtccgtgaaaaagatcattaccggcctgtagcaaacgtgctggaaggcgcaaaacag
aaggggaaagcaaccggcatcattgcaacatctgaaattcagcatgccacgcctgccggc
tattccggccatcataaagaccgcaataattttgaagtgctcggtgaacagcaggtttat
caaaacatggatgttgtccttggcggaggaaaagaatcgcttcagccgggtacaaaggat
aaaagccgcaaagacggtgaagaccttgtaaaagtgctcaaagataaaaagtacgatttc
gttgaaacgaaagatcaactcctcaagtcaaaatcgaaaaaaatctggggcgccttctca
cagcgcgatctcgcgtatgacatggaccgccgcgcaacgcatccagagcagccgactatt
gcagagatgacgaaaaaatcgattcagacgctttctaaagacaaggacggtttcttttta
ttcgtggaaggaagcaagcctgactgggcagcgcatcaaaacgatccgatcggcatgatc
agcgatgtattggcgtttgataacgcggtgaaagaagcgcttgatttcgctaaaaaagat
aaacatacaatggttattgccgtctcagaccatggcaacagcggcatctccatcggcaac
agcaacacgacgaaaggctatgacacaacaccggtatcagcctatgtcgatccgctgaaa
aaagctaaaatgacggtggaaggcgcaactggcaaattaaaagacgacttatcgaatatc
gaagaagcggcgaagctttacggacttgatgatttaacgccggcagagaaggaacagctg
aaaagcgtgaaaaacaaaaaagaagcggcttcattatttaccaagctgctcagcaaccgg
gccaacatcggattcacaacaggcggtcatacgggtgaagacgtcttcctgtattcgtat
ggtccagaaaagccgcagggtctcgtcgaaaacaccgatatcgccaaaacgatggcaaag
gcaatgggcttcaacttagacaaattaacaaacgaattatttatcgaagcaaaacaggca
tttaaaaaagccggagccagcgtaacgatcgatcaaaaagatccggctaacccagttctt
gtcgcagcgcgcaaaaaagcaaaagccgaaatgcctgtgaacaaaaacattatcagaatc
aacgggaaggaatacgaactagacagcgtgattgttgaaagcaatggatccttctacgtg
cctaaagaagcagttcagctattcaaaaaatacgccagataa

DBGET integrated database retrieval system