KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02779Help
Entry
BLi02779          CDS       T00200                                 

Gene name
thrC1
Definition
threonine synthase ThrC (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLi02779 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLi02779 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BLi02779 (thrC1)
Enzymes [BR:bld01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BLi02779 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2669465..2670568)
Genome map
AA seq 367 aa AA seqDB search
MEQYQCHSCRTKYNVSEQVWKCQCGGVLDLVKEKVEWSDSKVLKDIPSMWRYIEAMPFDR
DSAIWSGITMGEGYTPLIVLDSGEPNTLVKVDYMMPTLSFKDRGAAVLIAKAKELGVKHV
IADSSGNAGTSIAAYAKRAEIACDIFLRKGTSPKKIAQAKAHGANVREIEGTREDVAEAA
QKAVDIEKKFYASHVFNPYFYEGTKTYAFEIWEQMNGAPDTLIIPVGNGTLLLGVYYGFK
ELLENKCIDKMPRLVAIQAENCAPLAKAFINNQKAAEPVKSSGTLAEGIAIAKPARSAQI
LETIRATNGQIITTNEEEILKARTALASKGFYVEPTTAANYAGYLKYSHSSDEKIVIPLC
GAGIKSN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaacagtatcaatgtcattcttgccgtacgaaatacaatgtgtctgaacaggtgtgg
aaatgccagtgtggcggagtgttagaccttgtaaaagaaaaagtagaatggtccgattca
aaagtgctcaaagatattccttctatgtggagatatattgaagctatgccatttgatcgc
gactccgccatatggagcggcatcaccatgggggagggatacacgcctttaatcgtgtta
gacagcggggagccgaatactcttgtgaaagtggactatatgatgcctactttgtctttt
aaagatcgcggtgcggctgtattaatagctaaggcaaaggagctgggagtgaagcatgtg
atcgccgacagcagcggaaatgcagggacatctattgcagcttacgccaagcgggctgaa
atcgcatgtgacatctttcttcgaaagggtacatcgcctaagaaaatcgcgcaggcgaaa
gcgcatggagccaacgttcgcgaaattgaaggcacaagagaagatgtggctgaagcagcg
caaaaggctgtggatatagagaaaaaattctatgccagtcacgtttttaatccatatttc
tatgaaggaacaaaaacgtatgcctttgagatttgggaacaaatgaatggagcgccggat
acgcttattattccagttggcaatggtacgttattgcttggggtttactatggatttaaa
gagttattagagaacaaatgtatagacaaaatgccaaggctggttgcgatacaggcagag
aattgtgcgccgttggcaaaggcatttatcaacaatcaaaaagctgctgaacccgtcaaa
agcagcggaacacttgcagagggcatcgcgattgccaaaccggcaagatctgctcaaata
ttagaaaccatccgtgccacaaacggtcaaatcattacaaccaatgaggaagagattcta
aaagctcgtacagcattagcaagtaaaggcttttatgttgagccaacaacagcggctaac
tatgcaggatatttaaaatacagtcattcttctgatgaaaaaatcgtgattccattatgc
ggggctgggattaaatctaattag

DBGET integrated database retrieval system