KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02779Help
Entry
BLi02779          CDS       T00200                                 

Gene name
thrC1
Definition
(GenBank) threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00260  Glycine, serine and threonine metabolism
bld00750  Vitamin B6 metabolism
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01120  Microbial metabolism in diverse environments
bld01230  Biosynthesis of amino acids
Module
bld_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLi02779 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BLi02779 (thrC1)
Enzymes [BR:bld01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BLi02779 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAU41650
Position
complement(2669465..2670568)
Genome map
AA seq 367 aa AA seqDB search
MEQYQCHSCRTKYNVSEQVWKCQCGGVLDLVKEKVEWSDSKVLKDIPSMWRYIEAMPFDR
DSAIWSGITMGEGYTPLIVLDSGEPNTLVKVDYMMPTLSFKDRGAAVLIAKAKELGVKHV
IADSSGNAGTSIAAYAKRAEIACDIFLRKGTSPKKIAQAKAHGANVREIEGTREDVAEAA
QKAVDIEKKFYASHVFNPYFYEGTKTYAFEIWEQMNGAPDTLIIPVGNGTLLLGVYYGFK
ELLENKCIDKMPRLVAIQAENCAPLAKAFINNQKAAEPVKSSGTLAEGIAIAKPARSAQI
LETIRATNGQIITTNEEEILKARTALASKGFYVEPTTAANYAGYLKYSHSSDEKIVIPLC
GAGIKSN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaacagtatcaatgtcattcttgccgtacgaaatacaatgtgtctgaacaggtgtgg
aaatgccagtgtggcggagtgttagaccttgtaaaagaaaaagtagaatggtccgattca
aaagtgctcaaagatattccttctatgtggagatatattgaagctatgccatttgatcgc
gactccgccatatggagcggcatcaccatgggggagggatacacgcctttaatcgtgtta
gacagcggggagccgaatactcttgtgaaagtggactatatgatgcctactttgtctttt
aaagatcgcggtgcggctgtattaatagctaaggcaaaggagctgggagtgaagcatgtg
atcgccgacagcagcggaaatgcagggacatctattgcagcttacgccaagcgggctgaa
atcgcatgtgacatctttcttcgaaagggtacatcgcctaagaaaatcgcgcaggcgaaa
gcgcatggagccaacgttcgcgaaattgaaggcacaagagaagatgtggctgaagcagcg
caaaaggctgtggatatagagaaaaaattctatgccagtcacgtttttaatccatatttc
tatgaaggaacaaaaacgtatgcctttgagatttgggaacaaatgaatggagcgccggat
acgcttattattccagttggcaatggtacgttattgcttggggtttactatggatttaaa
gagttattagagaacaaatgtatagacaaaatgccaaggctggttgcgatacaggcagag
aattgtgcgccgttggcaaaggcatttatcaacaatcaaaaagctgctgaacccgtcaaa
agcagcggaacacttgcagagggcatcgcgattgccaaaccggcaagatctgctcaaata
ttagaaaccatccgtgccacaaacggtcaaatcattacaaccaatgaggaagagattcta
aaagctcgtacagcattagcaagtaaaggcttttatgttgagccaacaacagcggctaac
tatgcaggatatttaaaatacagtcattcttctgatgaaaaaatcgtgattccattatgc
ggggctgggattaaatctaattag

DBGET integrated database retrieval system