KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02842Help
Entry
BLi02842          CDS       T00200                                 

Gene name
yjjA
Definition
(GenBank) putative uroporphyrinogen III synthase YjjA
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00860  Porphyrin and chlorophyll metabolism
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BLi02842 (yjjA)
Enzymes [BR:bld01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BLi02842 (yjjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Oxidored_nitro DUF5333 DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: AAU41712
Position
complement(2727344..2728171)
Genome map
AA seq 275 aa AA seqDB search
MGKGLNGRRIAIGASRKTDEMSTLIKKQGGVPLIRSLQGTVFLAEKEVGPDLRAFVETGA
DWVIFTTGIGTETLVSLAEKLGIGERYLQAIRRAKAASRGYKTIAALKKLGITPVAADED
GTTKGLIDSLQSHDFSGKRVMVQLHGENAPSLLQFLEEKGADVVPLLPYRHVAPDRETVA
LLCSEIINREVDAVCFTTAVQVRSLFHFAKENGYAEKIVQSFQDSVLAAAVGKVTAEALR
EEGVERLLAPDLERMGAMIVELARFYETEEGIRTQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgggaaaaggattgaacggcagaagaattgccatcggagcatcgcgaaaaacggatgaa
atgagcacgctgatcaaaaagcaaggcggggttcccctcattcgctcccttcagggtacc
gtgtttttggccgaaaaagaagtaggccctgatttgcgtgccttcgttgaaacgggagcc
gactgggtgattttcacgaccggaatcgggacggaaacgcttgtcagcctagctgagaaa
cttgggatcggagagcgctatttacaagcgatccgcagggcgaaagcggcatcgagaggc
tacaaaacaatcgccgctttaaaaaagctcggcattacgcccgttgcggcggatgaagac
ggcacgaccaagggactgatcgactcgctccaatcccacgatttttccggcaaacgggtg
atggttcagctccacggcgaaaacgctccgtcactgcttcagtttttggaagagaaaggt
gcagacgttgttccgcttctgccgtatcggcatgttgctccagaccgggaaaccgtcgct
ttattgtgcagcgagatcatcaaccgtgaagtggatgcggtttgctttacaacggctgtc
caagtccgctcgctttttcatttcgcgaaagaaaacggctatgcggagaaaattgttcaa
tcttttcaagacagcgtgttggcggccgctgtcggaaaagtgacggcagaagctttaaga
gaagaaggagtcgaacgccttctcgctccggatctcgaacggatgggagcgatgattgtg
gagctagcgcggttttatgaaacggaagaggggataagaacacagtaa

DBGET integrated database retrieval system