KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02848Help
Entry
BLi02848          CDS       T00200                                 

Gene name
yrhJ
Definition
bifunctional cytochrome P450/NADPH-cytochrome P450 reductase YrhJ (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BLi02848 (yrhJ)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BLi02848 (yrhJ)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BLi02848 (yrhJ)
Enzymes [BR:bld01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BLi02848 (yrhJ)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BLi02848 (yrhJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2733094..2736318)
Genome map
AA seq 1074 aa AA seqDB search
MNKLDGIPIPKTYGPLGNLPLLDKNRVSQSLWKIADEMGPIFQFKFADAIGVFVSSHELV
KEVSEESRFDKNMGKGLLKVREFSGDGLFTSWTEEPNWRKAHNILLPSFSQKAMKGYHPM
MQDIAVQLIQKWSRLNQDESIDVPDDMTRLTLDTIGLCGFNYRFNSFYREGQHPFIESMV
RGLSEAMRQTKRFPLQDKLMIQTKRRFNSDVESMFSLVDRIIADRKQAESESGNDLLSLM
LHAKDPETGEKLDDENIRYQIITFLIAGHETTSGLLSFAIYLLLKHPDKLKKAYEEADRV
LTDPVPSYKQVQQLKYIRMILNESIRLWPTAPAFSLYAKEETVIGGKYLIPKGQSVTVLI
PKLHRDQSVWGEDAEAFRPERFEQMDSIPAHAYKPFGNGQRACIGMQFALHEATLVLGMI
LQYFDLEDHANYQLKIKESLTLKPDGFTIRVRPRKKEAMTAMPGAQPEENGRQEERPSAP
AAENTHGTPLLVLYGSNLGTAEEIAKELAEEAREQGFHSRTAELDQYAGAIPAEGAVIIV
TASYNGNPPDCAKEFVNWLEHDQTDDLRGVKYAVFGCGNRSWASTYQRIPRLIDSVLEKK
GAQRLHKLGEGDAGDDFEGQFESWKYDLWPLLRTEFSLAEPEPNQTETDRQALSVEFVNA
PAASPLAKAYQVFTAKISANRELQCEKSGRSTRHIEISLPEGAAYQEGDHLGVLPQNSEV
LIGRVFQRFGLNGNEQILISGRNQASHLPLERPVHVKDLFQHCVELQEPATRAQIRELAA
HTVCPPHQRELEDLLKDDVYKDQVLNKRLTMLDLLEQYPACELPFARFLALLPPLKPRYY
SISSSPQLNPRQTSITVSVVSGPALSGRGHYKGVASNYLAGLEPGDAISCFIREPQSGFR
LPEDPETPVIMVGPGTGIAPYRGFLQARRIQRDAGVKLGEAHLYFGCRRPNEDFLYRDEL
EQAEKDGIVHLHTAFSRLEGRPKTYVQDLLREDAALLIHLLNEGGRLYVCGDGSRMAPAV
EQALCEAYRIVQGASREESQSWLSALLEEGRYAKDVWDGGVSQHNVKADCIART
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagttagatggaattccaatccctaaaacttacgggccgctcggcaacctgcct
ttgcttgacaaaaacagggtctcccagtcactttggaaaatcgcggatgagatggggcct
atctttcaatttaagtttgcggatgcgattggggtttttgtgtccagccatgaactggtt
aaagaagtctctgaagaatcccgttttgacaaaaacatggggaaggggctattgaaagtt
cgcgagttcagcggagacgggctctttacaagctggacggaagaacccaattggcggaaa
gcccacaacatccttctgccgagcttcagccagaaagcgatgaagggataccatcccatg
atgcaggatatcgccgtccagctcattcaaaagtggtcccgtctcaatcaggatgaaagc
attgatgtgccggacgatatgacgcggctgacgctggacacgatcggcttatgcgggttt
aactaccgctttaacagcttctaccgtgaagggcagcatccgtttattgagagcatggtc
cggggtttgagcgaagcgatgagacagacgaagcgcttcccgctgcaggataagctgatg
attcaaacgaagcgccggtttaacagcgatgtcgagtcgatgttttctcttgttgaccgg
atcatcgctgaccggaagcaggccgagagtgaaagcggaaatgacctcttgtcgcttatg
cttcatgcgaaagaccctgagaccggcgaaaaactggatgatgagaatatccgctatcaa
attattacatttttgattgccggacacgagacgacgagcggtttattatcgtttgcaatc
tatctgctcctgaagcatccggataagcttaagaaagcgtatgaagaagcagaccgcgtg
ctgaccgatcccgtcccatcctacaaacaggttcagcagctgaaatacatccgaatgatt
ttgaatgaatcgataaggctttggccgacggcaccggctttctctctttatgcaaaagaa
gaaacggttatcgggggaaaatatttgattccaaaaggacagagcgttacagtgctcatc
ccaaaactgcacagagatcaaagcgtctggggagaagatgccgaggcattccggcctgaa
cggttcgagcagatggacagcattccggcgcacgcatacaaaccgtttggcaacggccaa
agggcatgcatcggcatgcagttcgcccttcatgaagcgacgcttgtgctcggcatgatt
cttcagtactttgatcttgaagatcatgcaaactaccaattgaagatcaaagaatcgctg
acattaaaaccggatggtttcacaatccgggtgaggccgaggaaaaaagaagcaatgacg
gcgatgccgggcgctcagcctgaagagaacggacggcaggaagaacggccttccgcaccg
gcggcggaaaatacgcacggaacccctcttcttgtgctctacggttcaaatctcggcaca
gccgaagagattgcgaaggagcttgctgaagaagcgcgtgagcaagggtttcacagccgg
acggcggagcttgatcaatacgcaggcgccatcccggcagaaggggctgttatcattgtg
acggcttcctataacggaaacccgcccgattgcgcaaaggaatttgtcaattggcttgag
catgatcagacagacgatttgcgtggtgtcaaatatgcggtattcggctgcggtaaccgc
agctgggccagcacctaccagcggattccgcgcctgattgacagcgtattggaaaaaaaa
ggcgcccaaaggctgcacaagcttggagaaggggatgcaggcgatgattttgaaggacag
tttgagtcatggaaatatgatctgtggccgcttttaagaaccgaattttcattggccgaa
cccgagccgaatcaaacagaaacagacaggcaagccttatctgtcgagttcgtaaacgca
cctgcggcttcgccgctggctaaagcttatcaggtgttcacagcgaagatatcggcaaac
cgagaactgcagtgtgaaaagagcgggagaagcacaaggcatattgaaatatcgcttcct
gaaggcgccgcatatcaggagggagaccatctcggtgtgctaccgcaaaacagcgaagtg
ctgattggccgcgtttttcagcggtttgggctgaacggaaatgaacaaattctgattagc
ggccggaatcaagcatcacatttgcctttggagaggcccgttcatgtcaaagaccttttt
caacattgcgtcgagctccaggaaccggccacaagggcccagatacgcgagctggcggct
catactgtttgtccgcctcatcagcgcgagcttgaagacctgctgaaagatgacgtctat
aaggatcaagtgttgaataagcggctgacaatgcttgacctgcttgagcaatacccggcc
tgtgaactgccgttcgcccgttttctggcgcttcttcctccgctaaaaccgaggtactat
tcgatttccagttcgccgcagcttaacccgcggcaaacaagcatcaccgtctctgtcgta
agtggcccggcgttgagcggccgcgggcattataagggagttgcatcgaactatctcgcc
ggccttgagccgggagacgcgatttcgtgtttcatcagagagcctcagtcaggcttccgg
cttcccgaagatcctgaaacaccggtgatcatggtcgggccgggcaccggaatcgcccct
taccgcggatttcttcaggcgcgccgcatccagcgcgatgccggtgtgaagctcggtgaa
gcgcatttgtacttcggctgccgccgtccgaacgaagattttctgtatcgagacgagttg
gagcaagcggaaaaggacggaatcgtccatctgcatacagcgttttcccggcttgagggc
cggccgaaaacatatgtgcaagatttgctcagagaggatgcagccttgctgattcacttg
ttgaacgaaggcggccgcctgtatgtgtgcggagacggaagccgcatggctccagctgtt
gaacaagctttgtgcgaggcgtatcgcatagtacagggtgcgagtcgggaagagtcgcaa
agctggctgtccgcacttttagaagaagggcgctatgcaaaggatgtatgggacggcggc
gtttcccaacataatgtgaaggcggactgcattgcaagaacgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system