KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02848Help
Entry
BLi02848          CDS       T00200                                 

Gene name
yrhJ
Definition
bifunctional cytochrome P450/NADPH-cytochrome P450 reductase YrhJ (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bld00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bld00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bld00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2733094..2736318)
Genome map
AA seq 1074 aa AA seqDB search
MNKLDGIPIPKTYGPLGNLPLLDKNRVSQSLWKIADEMGPIFQFKFADAIGVFVSSHELV
KEVSEESRFDKNMGKGLLKVREFSGDGLFTSWTEEPNWRKAHNILLPSFSQKAMKGYHPM
MQDIAVQLIQKWSRLNQDESIDVPDDMTRLTLDTIGLCGFNYRFNSFYREGQHPFIESMV
RGLSEAMRQTKRFPLQDKLMIQTKRRFNSDVESMFSLVDRIIADRKQAESESGNDLLSLM
LHAKDPETGEKLDDENIRYQIITFLIAGHETTSGLLSFAIYLLLKHPDKLKKAYEEADRV
LTDPVPSYKQVQQLKYIRMILNESIRLWPTAPAFSLYAKEETVIGGKYLIPKGQSVTVLI
PKLHRDQSVWGEDAEAFRPERFEQMDSIPAHAYKPFGNGQRACIGMQFALHEATLVLGMI
LQYFDLEDHANYQLKIKESLTLKPDGFTIRVRPRKKEAMTAMPGAQPEENGRQEERPSAP
AAENTHGTPLLVLYGSNLGTAEEIAKELAEEAREQGFHSRTAELDQYAGAIPAEGAVIIV
TASYNGNPPDCAKEFVNWLEHDQTDDLRGVKYAVFGCGNRSWASTYQRIPRLIDSVLEKK
GAQRLHKLGEGDAGDDFEGQFESWKYDLWPLLRTEFSLAEPEPNQTETDRQALSVEFVNA
PAASPLAKAYQVFTAKISANRELQCEKSGRSTRHIEISLPEGAAYQEGDHLGVLPQNSEV
LIGRVFQRFGLNGNEQILISGRNQASHLPLERPVHVKDLFQHCVELQEPATRAQIRELAA
HTVCPPHQRELEDLLKDDVYKDQVLNKRLTMLDLLEQYPACELPFARFLALLPPLKPRYY
SISSSPQLNPRQTSITVSVVSGPALSGRGHYKGVASNYLAGLEPGDAISCFIREPQSGFR
LPEDPETPVIMVGPGTGIAPYRGFLQARRIQRDAGVKLGEAHLYFGCRRPNEDFLYRDEL
EQAEKDGIVHLHTAFSRLEGRPKTYVQDLLREDAALLIHLLNEGGRLYVCGDGSRMAPAV
EQALCEAYRIVQGASREESQSWLSALLEEGRYAKDVWDGGVSQHNVKADCIART
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagttagatggaattccaatccctaaaacttacgggccgctcggcaacctgcct
ttgcttgacaaaaacagggtctcccagtcactttggaaaatcgcggatgagatggggcct
atctttcaatttaagtttgcggatgcgattggggtttttgtgtccagccatgaactggtt
aaagaagtctctgaagaatcccgttttgacaaaaacatggggaaggggctattgaaagtt
cgcgagttcagcggagacgggctctttacaagctggacggaagaacccaattggcggaaa
gcccacaacatccttctgccgagcttcagccagaaagcgatgaagggataccatcccatg
atgcaggatatcgccgtccagctcattcaaaagtggtcccgtctcaatcaggatgaaagc
attgatgtgccggacgatatgacgcggctgacgctggacacgatcggcttatgcgggttt
aactaccgctttaacagcttctaccgtgaagggcagcatccgtttattgagagcatggtc
cggggtttgagcgaagcgatgagacagacgaagcgcttcccgctgcaggataagctgatg
attcaaacgaagcgccggtttaacagcgatgtcgagtcgatgttttctcttgttgaccgg
atcatcgctgaccggaagcaggccgagagtgaaagcggaaatgacctcttgtcgcttatg
cttcatgcgaaagaccctgagaccggcgaaaaactggatgatgagaatatccgctatcaa
attattacatttttgattgccggacacgagacgacgagcggtttattatcgtttgcaatc
tatctgctcctgaagcatccggataagcttaagaaagcgtatgaagaagcagaccgcgtg
ctgaccgatcccgtcccatcctacaaacaggttcagcagctgaaatacatccgaatgatt
ttgaatgaatcgataaggctttggccgacggcaccggctttctctctttatgcaaaagaa
gaaacggttatcgggggaaaatatttgattccaaaaggacagagcgttacagtgctcatc
ccaaaactgcacagagatcaaagcgtctggggagaagatgccgaggcattccggcctgaa
cggttcgagcagatggacagcattccggcgcacgcatacaaaccgtttggcaacggccaa
agggcatgcatcggcatgcagttcgcccttcatgaagcgacgcttgtgctcggcatgatt
cttcagtactttgatcttgaagatcatgcaaactaccaattgaagatcaaagaatcgctg
acattaaaaccggatggtttcacaatccgggtgaggccgaggaaaaaagaagcaatgacg
gcgatgccgggcgctcagcctgaagagaacggacggcaggaagaacggccttccgcaccg
gcggcggaaaatacgcacggaacccctcttcttgtgctctacggttcaaatctcggcaca
gccgaagagattgcgaaggagcttgctgaagaagcgcgtgagcaagggtttcacagccgg
acggcggagcttgatcaatacgcaggcgccatcccggcagaaggggctgttatcattgtg
acggcttcctataacggaaacccgcccgattgcgcaaaggaatttgtcaattggcttgag
catgatcagacagacgatttgcgtggtgtcaaatatgcggtattcggctgcggtaaccgc
agctgggccagcacctaccagcggattccgcgcctgattgacagcgtattggaaaaaaaa
ggcgcccaaaggctgcacaagcttggagaaggggatgcaggcgatgattttgaaggacag
tttgagtcatggaaatatgatctgtggccgcttttaagaaccgaattttcattggccgaa
cccgagccgaatcaaacagaaacagacaggcaagccttatctgtcgagttcgtaaacgca
cctgcggcttcgccgctggctaaagcttatcaggtgttcacagcgaagatatcggcaaac
cgagaactgcagtgtgaaaagagcgggagaagcacaaggcatattgaaatatcgcttcct
gaaggcgccgcatatcaggagggagaccatctcggtgtgctaccgcaaaacagcgaagtg
ctgattggccgcgtttttcagcggtttgggctgaacggaaatgaacaaattctgattagc
ggccggaatcaagcatcacatttgcctttggagaggcccgttcatgtcaaagaccttttt
caacattgcgtcgagctccaggaaccggccacaagggcccagatacgcgagctggcggct
catactgtttgtccgcctcatcagcgcgagcttgaagacctgctgaaagatgacgtctat
aaggatcaagtgttgaataagcggctgacaatgcttgacctgcttgagcaatacccggcc
tgtgaactgccgttcgcccgttttctggcgcttcttcctccgctaaaaccgaggtactat
tcgatttccagttcgccgcagcttaacccgcggcaaacaagcatcaccgtctctgtcgta
agtggcccggcgttgagcggccgcgggcattataagggagttgcatcgaactatctcgcc
ggccttgagccgggagacgcgatttcgtgtttcatcagagagcctcagtcaggcttccgg
cttcccgaagatcctgaaacaccggtgatcatggtcgggccgggcaccggaatcgcccct
taccgcggatttcttcaggcgcgccgcatccagcgcgatgccggtgtgaagctcggtgaa
gcgcatttgtacttcggctgccgccgtccgaacgaagattttctgtatcgagacgagttg
gagcaagcggaaaaggacggaatcgtccatctgcatacagcgttttcccggcttgagggc
cggccgaaaacatatgtgcaagatttgctcagagaggatgcagccttgctgattcacttg
ttgaacgaaggcggccgcctgtatgtgtgcggagacggaagccgcatggctccagctgtt
gaacaagctttgtgcgaggcgtatcgcatagtacagggtgcgagtcgggaagagtcgcaa
agctggctgtccgcacttttagaagaagggcgctatgcaaaggatgtatgggacggcggc
gtttcccaacataatgtgaaggcggactgcattgcaagaacgtaa

DBGET integrated database retrieval system