KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02873Help
Entry
BLi02873          CDS       T00200                                 

Gene name
yrrC
Definition
exodeoxyribonuclease subunit YrrC
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bld00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BLi02873 (yrrC)
Enzymes [BR:bld01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BLi02873 (yrrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2761102..2763498)
Genome map
AA seq 798 aa AA seqDB search
MQRHNPDQIEMEEASFVKGTVTAVIYHNETNLYTVLKVKVEETSESFEDKTVSVTGYFPL
IHEDDIYTFYGKTASHPKFGLQFQADHFKKEVPTTKEGVIQYLASDLFEGIGKKTAEEIV
NKLGEGAINKILSDGAVLYDVPKLSKKKADKLAAALQQHQGLEQIMISLSEFGFGPQLSM
KIYQAYEAETLDKIRENPYQLVKDVEGIGFIKADELGGRMGISGKHEERIKAAILYTVEA
TCLQEGHTYIETRQLIIETQKLLNQSAGDEKVTEMDVADAIISLGEQKELFIEDERCYYP
SLYYAEQSFAKRVQKIAGQTEYDDQFPESEFLLALGELEERMKVQYAPSQKEAIQKALMS
PMLLLTGGPGTGKTTVIRGIVELYSELHGLSLNPADYKKDETFPFVLAAPTGRAAKRMSE
STGLPAVTIHRLLGWNGAEGFTHDEDNPIEGRLLIIDETSMLDIWLANQLFKAIPDRIQV
IMVGDEDQLPSVGPGQVLRDLLASNVIPSVRLTDIYRQAEGSSIVELAHEMKQGKLPENL
AAPTKDRSFIRCRQQQIKEVVEKVVKNALQKGYSARDIQVLAPMYRGAAGINELNALLQG
ILNPPKPKGREMKYGDVVYRTGDKVLQLVNQPEHNVFNGDMGEIVSIFYAKENTEKEDMA
VVSFDGNEITFAKKDFNQFTHAYCCSIHKSQGSEFPIVILPVVKSYYRMLRRNLLYTAIT
RSKKFLILCGEEEALEWGVKNKESSERQTSLKRRLQQAAHEEDEELMALQKELPFSVYDA
NIGMEGITPFDFMEKEAE
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccataacccggaccagatcgaaatggaagaagcttcatttgtaaaaggaacg
gtaacggctgtcatatatcataatgaaacaaacctgtataccgtactgaaagtaaaagtg
gaagaaacatcagagtcttttgaagacaaaaccgtttctgtcaccggttactttcctttg
atccatgaagacgatatctacacattttacggaaaaaccgcctcccatccgaaatttggc
ctgcaatttcaagcggatcatttcaaaaaggaagtgccgacaacgaaagaaggcgtgatc
caatacttggccagcgatttatttgaaggaatcggcaagaaaacggccgaggaaattgtc
aataagctgggggaaggggcaatcaacaaaattttaagcgacggcgccgtcctgtatgat
gtcccgaagctctccaaaaaaaaggcggataagcttgccgctgcccttcagcagcatcag
gggctcgagcagattatgatctccttgagcgaattcggcttcggcccccagctgtccatg
aaaatttatcaggcgtacgaagcggaaacgctcgataaaatccgcgaaaatccgtaccag
cttgtcaaagatgttgaaggaatcggctttatcaaagcagacgaactgggcggcagaatg
gggatctcaggcaaacatgaagagcggatcaaagcggcgattttatacacggttgaagcg
acatgccttcaagaagggcatacgtacatagaaacgagacagctcatcatcgagacgcaa
aagctgttaaaccagtcagcaggcgatgaaaaagtaaccgagatggatgtggcggacgcg
atcatttccttaggggagcaaaaagagctgttcattgaagatgaaaggtgttattatccg
tccctttactacgctgaacaaagctttgccaaaagggtgcagaaaatcgccggacagacc
gaatacgatgaccagtttcccgaatcggaattcctgctcgctttaggggagcttgaagaa
cggatgaaagtgcagtacgcgccaagccaaaaagaagccatacaaaaagcgctgatgtcg
ccgatgctgcttttgacgggcggaccgggaaccgggaaaacgaccgtcatcaggggaatc
gtcgagttgtacagcgagctgcacggcttaagcttaaatccggctgattacaaaaaagat
gaaacgtttccgtttgtgctggcagcaccgaccggccgggccgctaagcggatgagcgag
tcgaccggtctgccggccgttacgattcacaggcttctcggctggaacggagccgaagga
tttacgcacgatgaagacaatccgattgaaggacggctgctcattattgatgaaacgagc
atgcttgatatatggcttgccaaccaattattcaaggcgatccccgatcggatacaggtg
atcatggtcggagatgaagaccagcttccgtccgtcggtcccggacaggtgctaagggat
ctgttggcatcgaatgtgattccttctgtcagattaaccgacatttacagacaggctgaa
ggctcttcaatcgttgaactggcgcacgaaatgaaacagggaaagcttccggaaaacttg
gccgccccgacaaaagaccgttcttttattcgctgccgccagcagcagatcaaagaagtc
gtcgaaaaagtcgtcaaaaacgcgctgcaaaaaggatattcggccagggatattcaggtt
ttggctccgatgtacagaggagcggccggcatcaatgagttgaacgcccttttgcagggc
atactgaatccgccgaagccgaaaggcagggaaatgaagtacggagatgtcgtgtaccgt
accggagataaagtgctccagctcgtcaaccagccggagcataacgtgtttaacggtgac
atgggcgagatcgtctcgattttttatgcgaaagaaaatacggaaaaagaagatatggcc
gttgtctctttcgacgggaatgaaatcacgtttgcaaaaaaagatttcaaccagtttacg
cacgcctattgctgttcgatccacaaatcgcaaggcagcgaatttccgatcgtcatcctt
ccggtcgtcaaaagctattaccggatgctgagaaggaacttgctttacacggctattaca
agaagcaaaaaattcctgattctgtgcggcgaagaggaagcccttgaatggggcgtgaaa
aataaggaatcatcagaaaggcagacatcgcttaaaagacggcttcagcaggcggcacat
gaagaggatgaagagctcatggcgcttcaaaaagagctgccattcagcgtctatgacgcc
aatatcgggatggaaggcattacaccttttgattttatggaaaaggaagcagaataa

DBGET integrated database retrieval system