KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02901Help
Entry
BLi02901          CDS       T00200                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bld00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BLi02901 (ruvA)
Enzymes [BR:bld01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BLi02901 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2791156..2791761)
Genome map
AA seq 201 aa AA seqDB search
MIEFVKGTIDYVSPQYIVIENGGIGYQIFTPNPFIYKKNSKETIYTYHYVREDTNALYGF
STREEKMLFTKMLNVTGIGPKGALAILASGDPGAVIEAIENEDEAFLVKFPGVGKKTARQ
IILDLKGKLADAVPEIAADLFNHEEREQIHEAATALEEALEALRALGYSDREIKKVQPHL
KKEEALSTDQYVKKALQKLLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaattcgtaaaagggacgattgattatgtatcgccccaatatattgtcattgaa
aacggcgggatcggctatcagatcttcacgccaaatccgtttatttataagaaaaacagc
aaagaaacaatctatacataccattatgtaagagaagacacgaatgcgctgtacggcttt
tcgacaagggaagaaaaaatgctgtttacgaaaatgctgaatgttacggggatcggccca
aaaggagcgcttgcgatcctcgcttccggcgatccgggagcggtgattgaagcgatcgag
aatgaggacgaagcatttctcgtcaaatttcccggcgtaggcaaaaaaacggcaaggcag
atcatccttgacctgaaagggaagcttgcggatgccgttcctgaaatcgctgccgatctg
tttaaccatgaagagcgggagcaaattcatgaagcggcaacggctcttgaggaagcgctt
gaagcattgagggcgctcggctattccgatcgggaaattaaaaaagtccagcctcatttg
aaaaaggaagaggcgctttcgacagatcaatacgttaaaaaagcattgcaaaaattgtta
aagtaa

DBGET integrated database retrieval system