KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02943Help
Entry
BLi02943          CDS       T00200                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BLi02943 (hemB)
Enzymes [BR:bld01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BLi02943 (hemB)
Exosome [BR:bld04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BLi02943 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2827955..2828929)
Genome map
AA seq 324 aa AA seqDB search
MEASFQRHRRLRTTAGMRKLVRETELRASDFIYPIFVTEEENVKSEVPSMPGVYQLSLDR
LKEEMEEVASLGIQSVIVFGVPEHKDDVGSGAYHDHGIVQKAIAQIKQDFPELVVIADTC
LCEYTDHGHCGLVENGEILNDESLVLLAKTAVSQARAGADIIAPSNMMDGFVAAIREALD
QEGFTNVPIMSYAVKYASAFYGPFRDAAGSSPQFGDRKTYQMDYANRREALREAKSDVEE
GADVLIVKPTLSYLDIVREVKNEFNLPVVGYNVSGEYAMVKAAAQNGWIEEKALVLEMLT
SMKRAGADLIITYFAKDAAKWISE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaagcatcatttcaaagacaccgccgcctgcggacgacagcaggtatgcggaaattg
gtaagggaaaccgagttaagagcatctgatttcatttatccgatatttgttaccgaggaa
gagaacgtcaaaagcgaagttccttctatgccgggcgtgtaccagctgtctttggaccgt
ttgaaagaggagatggaggaagtcgcaagcctcggcattcaatctgtgatcgtcttcggc
gtgcctgagcacaaagatgatgtgggaagcggagcctatcacgatcacggcatcgtccaa
aaagcgattgcacaaattaaacaggactttcctgaacttgtcgttatcgccgatacgtgc
ctatgcgagtacacggaccacggtcactgcggcctggtggaaaacggtgaaattttaaat
gacgaatcgcttgttcttttggcaaaaaccgctgtcagccaagcccgtgcaggtgctgac
attattgcgccgtcaaacatgatggacggtttcgttgccgctatcagggaagcgcttgat
caggaaggatttacaaatgtgccgatcatgtcgtacgctgtaaaatatgcgagcgctttt
tacggaccgttccgcgatgctgcgggaagcagtccgcagtttggcgaccgcaagacgtac
caaatggattatgccaaccgcagggaagctctccgggaggcaaaatccgatgtggaagaa
ggcgccgatgttctgatcgtcaagccgacgctttcatatcttgatatcgtcagagaagtg
aagaacgaatttaacctgcctgttgtcggatacaatgtgagcggggagtatgctatggtc
aaagccgccgcccaaaacggatggattgaagaaaaagctcttgttctcgaaatgctgaca
agcatgaagcgggctggcgccgatttgatcattacgtactttgcaaaagacgcggcaaaa
tggatttcggaataa

DBGET integrated database retrieval system