KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03001Help
Entry
BLi03001          CDS       T00200                                 

Gene name
fadB
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bld01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bld00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2882569..2883345)
Genome map
AA seq 258 aa AA seqDB search
MAALSYAVDGHVATITIQHPPANALSTQVLEDLSACLDELSERQDVRSVVIHGEGRFFSA
GADIKEFTSLMDGSDYANLADKGQQIFEKVESFPKPVIAAIHGAALGGGLELAMACHIRI
AEESAKLGLPELNLGIIPGFAGTQRLPKYVGTAKALEMIGTSEPISGKEAFEYGLVTILA
ANEEEVLQKAKELAQKFAEKSPQTMAYVIELLNSSKVYSYEGGLKLEGKYFGEVFQSEDA
KEGIQAFLEKRKPHFKGK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcagcattatcatacgccgtagacggccatgttgcgacgattacgattcagcacccg
ccggcaaatgcgctatcgacgcaagtgcttgaagatctttcggcatgccttgatgaactt
tcagaacgtcaggatgtcagaagcgtcgttattcacggggaaggaagatttttctcggca
ggcgctgatattaaagagtttacatcattgatggacgggtctgattatgcaaatttggct
gataagggccagcagattttcgaaaaagtagaatcttttccaaaaccggtgatcgccgcg
attcacggggccgctcttggaggcggtcttgagctagcgatggcatgccacatccggatt
gccgaggaaagcgcaaagctcggccttcccgaactgaatctcggaatcattcccggcttt
gcgggaacgcagcgccttcccaagtatgtgggcaccgccaaagcgcttgaaatgatcggg
acatcagagccgatatccggcaaggaagcttttgaatacggtcttgtcacgattttggcg
gcgaatgaagaagaagtgctgcaaaaggcaaaagagctcgcacaaaaattcgctgaaaaa
agtccgcagacgatggcttatgtcattgaactcctgaattcgagcaaagtgtattcgtat
gaaggaggcctcaagctagaagggaaatacttcggcgaagtgttccaatccgaggatgcg
aaggaagggattcaggcatttcttgaaaagcggaagccgcattttaaagggaaataa

DBGET integrated database retrieval system