KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03098Help
Entry
BLi03098          CDS       T00200                                 

Gene name
ytcI
Definition
(GenBank) putative acyl-coenzyme A synthetase YtcI
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00010  Glycolysis / Gluconeogenesis
bld00620  Pyruvate metabolism
bld00640  Propanoate metabolism
bld00680  Methane metabolism
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01120  Microbial metabolism in diverse environments
bld01130  Biosynthesis of antibiotics
bld01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLi03098 (ytcI)
   00620 Pyruvate metabolism
    BLi03098 (ytcI)
   00640 Propanoate metabolism
    BLi03098 (ytcI)
  Energy metabolism
   00680 Methane metabolism
    BLi03098 (ytcI)
Enzymes [BR:bld01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BLi03098 (ytcI)
Lipid biosynthesis proteins [BR:bld01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BLi03098 (ytcI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AAU41960
Position
complement(2982347..2983936)
Genome map
AA seq 529 aa AA seqDB search
MRREDLIAPEKYNAVDEIEKFKSSRDKTALIWEDESGRQVSWSYEKLIEKAYKIGSILTR
SGLKKGDKLIVMMPRIPETYAVYMAILKAGMVVIPCSEMLRAKDLDYRIKHAGVKGAVVY
SAFLDAFLDVRSKEALSLFAVGESSEGWINLLEKMNQAIAADFQAADTSRDDIAFLSYTS
GTTGQPKGVVHTHGWAYAHLRTTASAWLDISEGDLVWATAGPGWQKWVWSPFLAVLGSGA
TGFIYHGKFTPETYLRLIERHQVNVLCCTPTEYRFMAKVNDLSRFDLSSLHSAVSAGEPL
NREVIDTFKKHFHIAVRDGYGQTESTLLVGILKGMKIKPGSMGKPTPGNLVDIIDGNGKS
CPPGETGDIAVHLSTPALFKEYYKDQERTLRQRRGDYFITGDKARKDEDGYFWFESRNDD
VIISSGYTIGPFEVEDALIKHPEVKECAVVASPDEIRGSIVKAYVVLKDPSRGNEHLTKE
LQDHVKAMTAPYKYPREIEFIEELPKTPSAKIKRFELRQREIALKTKAE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
ttgagaagagaagatttgattgcgccggagaagtataatgcggttgatgaaattgaaaaa
tttaaatcttcccgcgataagaccgcattgatctgggaagatgaatcagggcgtcaagtg
tcatggtcctatgaaaaattgattgaaaaggcttacaaaatcggcagcatattgacccgt
tctggactgaaaaaaggtgacaagcttatcgtgatgatgccgcggataccggaaacgtat
gccgtgtacatggccattttaaaagctggaatggtggtcatcccatgttccgaaatgctt
cgggcgaaagacttggattacaggatcaagcatgcaggcgtcaaaggagccgtcgtatat
tcagcatttcttgatgcttttctagatgttcgttcaaaagaggcactgtcgttatttgcc
gtcggagaaagcagcgaagggtggatcaatctgctcgaaaaaatgaatcaggccattgca
gcggattttcaagcggcggatacctctcgcgatgacatcgcatttttatcttacacatcc
ggcacgaccggtcagccaaaaggggttgtacatacacacggctgggcttatgctcactta
agaacgacagcttccgcatggcttgacatttcggaaggggatctcgtctgggcgacagca
gggccgggctggcaaaaatgggtatggagcccgtttttagcagtgctcggtagcggtgca
accggctttatctatcatggaaaattcacgccggaaacgtatttgcggctgattgagcgc
catcaagtcaatgtgctgtgctgtacgccgacagagtaccggttcatggcgaaagtcaat
gatttgtcccgatttgacctgtcttctctgcacagcgctgtttcggccggagagccgttg
aacagggaagtcatcgatacatttaaaaagcattttcatattgctgtgcgggacggatac
ggacaaacggagagcacgctgttggtggggattttaaaaggtatgaaaatcaagcctgga
agcatgggaaaaccgacgcctggaaacttggttgatattattgacgggaatggaaagagc
tgtcccccgggcgaaacaggcgatattgccgttcacttaagcacgccggctctttttaaa
gaatattacaaagatcaagaacgaacgctccgacaaagaagaggggattactttataaca
ggggataaggcgcgaaaggatgaagacggctatttttggtttgaaagccgcaatgacgat
gtgatcatcagctcaggatatacaatcggcccgtttgaagttgaagatgcgctgatcaag
catcctgaggtcaaagaatgtgctgttgtggcaagccctgatgaaatcaggggatcgatc
gtgaaagcatacgttgtcttaaaggacccatcccgcggaaatgaacacctgacaaaggaa
ttacaagaccatgtaaaagccatgacggccccttataaatacccccgggagatagaattc
atcgaagaactgccgaaaacgccttcggcgaaaatcaagcgctttgaactaagacaacgg
gaaatcgcacttaaaacgaaagctgaataa

DBGET integrated database retrieval system