KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03151Help
Entry
BLi03151          CDS       T00200                                 

Gene name
ytjP
Definition
dipeptidase PepV (EC:3.4.13.-)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLi03151 (ytjP)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BLi03151 (ytjP)
Enzymes [BR:bld01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BLi03151 (ytjP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3031983..3033374)
Genome map
AA seq 463 aa AA seqDB search
MNWEQEVLKRRNEIVEDIQGFLKINSVLDEETAGPGRPFGKGIQECLTALLNKGEESGFT
VKNLDGYAGHIEWGKGEEIIGVLCHIDVVPPGDGWTSDPFAAEIRGGRIYARGALDDKGP
TMAAFHALKIVKDSGLPLSKRIRMIIGTDEESDWRCVEHYFKHEEMPSAGFAPDADFPII
YAEKGLIDAALKIETDQAETGADLVLEAFRSGRRLNMVPDDAEAVLAGAVPSEFEESFAR
FVKEKRAEGRILQEGGRLTLTVHGKSAHAMEPNNGVNAGLILAEFLHTQSLDRAGLHFVQ
TVSGAFAGDTRGKKIGIGCRDDISGELTLNVGRLQYEQGKGGEAHINIRYPVTEESGRVK
SGLSQIKGARLISFKDSKPHHVAKDHELIKTLQRVYEEQTGETAQLISIGGATYARSLKA
GVAFGPLFPGRPDVAHQKDEYMEIDDLLKAVSIYAQAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaacaggaagttttaaaaagacggaatgagatcgttgaggatattcagggt
tttttaaaaatcaacagcgtccttgacgaagagacggcgggtccgggacggccgtttgga
aaagggattcaagaatgcctgacagcgcttctgaataaaggggaggaaagcgggtttacg
gtaaaaaaccttgacggttatgcaggccatatcgaatgggggaaaggcgaggagattatc
ggcgtgctttgccacattgatgtcgttcctcccggcgatggatggacgagcgacccgttt
gcagctgaaataaggggcggccgaatctatgcaagaggagcgcttgatgataaagggccg
acaatggccgcgtttcatgcattaaaaattgtcaaagactcgggcctccctttatcaaaa
cggatcagaatgattattggaaccgatgaagaaagcgactggcgctgtgtggagcattac
tttaaacacgaagaaatgccttcggccggttttgcgcctgatgctgattttccgattatc
tatgcagaaaaaggcctgattgacgcagctttaaaaattgaaactgatcaggcggaaaca
ggtgcggacttagtattggaggcattccggtccggccggcgcctgaacatggtgcctgat
gatgcggaagccgtcctggcaggggccgtcccgtcagaatttgaagagtcatttgcccgg
tttgtaaaagaaaaacgcgcagaagggcgtattcttcaagaaggcggcagactgacatta
accgtgcacggcaaatcggctcatgccatggaacctaataacggagtcaatgccggtctc
attttggccgagtttttacatacacaatcccttgacagagccgggctccattttgttcaa
acggttagcggggcttttgccggagatacgagagggaaaaagatcggcatcggctgccgc
gatgacatcagcggagagctgacgctgaatgtcggccggctgcagtatgaacaaggaaaa
ggcggggaggcccatattaacatccgctatcctgttactgaagagagcggccgggtgaaa
tccgggctttcacaaataaaaggcgcccggctcatcagctttaaagacagcaagccacat
catgtagcaaaagaccatgaactgatcaaaacgctgcagcgggtctatgaagagcagaca
ggggaaacggcacaattaatttccatcggcggggcgacatatgcacgatcactgaaagcc
ggcgtggcattcggcccgctgtttccaggccgtcctgacgttgcccatcagaaagacgag
tatatggaaatcgacgatttgctgaaggctgtatcgatttatgcacaggccatttatgaa
ttggcgaagtag

DBGET integrated database retrieval system