KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03191Help
Entry
BLi03191          CDS       T00200                                 

Gene name
ytpA
Definition
phospholipase YtpA (EC:3.1.1.-)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bld00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3073672..3074451)
Genome map
AA seq 259 aa AA seqDB search
MWCMEAERPVATIVVIHGACEHHGRYKWLSEMWRSSGFNVVMGDLPGQGTSTRERGHIRS
FQEYIDEVDKWVARAKAFELPVFMLGHSMGGLIAIEWFKQQQSGIAGLILSSPCLGLQLK
PNKFLDLISKGLNVLAPSMRFESGITPDKATRNKEVIEMDINDSLYITKVSVRWYQEMLK
ALKSAMEPTDAFLNIPLFVMQAGTDWLVDKKMVVKWFNQLASHNKTYREWDGLYHEIFNE
PEREDVFKAARAFAEQYIT
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgcatggaagcggaaagacctgttgctacaatcgtcgtcattcacggtgcatgt
gagcatcacgggcggtataaatggctgtccgaaatgtggcgttcatccggctttaatgtc
gtgatgggggatttgcccggccagggcacttcgacaagagaaagaggacatatacgctct
tttcaagaatatattgatgaagtggacaaatgggtcgccagggcgaaagcatttgaactg
cctgtgtttatgctcgggcacagcatgggcggcctgattgcgatcgaatggtttaagcag
cagcaaagcggcattgccggtctcattttatcatccccttgtctcgggctgcaattaaag
ccgaacaaatttctggacttgatttccaaggggctcaacgttttggcgccgtctatgcgg
tttgaatccgggatcacgcctgataaagcgacgagaaacaaagaagtcatcgaaatggac
atcaacgattcattatatatcacaaaagtttctgtcagatggtatcaagaaatgttaaaa
gcgttgaaaagcgcgatggagccgacggacgcctttctcaacatcccgctctttgtcatg
caggcgggcaccgactggcttgtcgacaaaaaaatggtcgtcaagtggtttaaccagctt
gcttcccacaataagacgtacagggaatgggatggcttgtaccacgaaattttcaatgag
cctgaacgggaagacgtttttaaagcggccagagcgtttgcggagcagtatataacataa

DBGET integrated database retrieval system