KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03413Help
Entry
BLi03413          CDS       T00200                                 

Gene name
thrC2
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLi03413 (thrC2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLi03413 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BLi03413 (thrC2)
Enzymes [BR:bld01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BLi03413 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3259136..3260203)
Genome map
AA seq 355 aa AA seqDB search
MELMWKGLIHQYKEYLPVTDKTPELTLNEGNTPLIYLQNLSKKLGIELYVKTEGVNPTGS
FKDRGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARANMKCIVIIPDGKIAFGKLAQ
AVMYGAEIIAIDGNFDDALKMVRSICEKEPIALVNSVNPYRIEGQKTASFEICEQLGEAP
DILAIPVGNAGNITAYWKGFKEYHEKNGTGLPVMKGFQAEGAAPIVKNKVIEKPETVATA
IRIGNPASWDKAVNAAKESNGKIDAVSDEEILHAYQLLAREEGVFAEPGSCASIAGVLKQ
LQTKEIQPGAKVVAVLTGNGLKDPNTAVDVSQIKPVTLPTDEEAILEHLKGAARV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttggagctaatgtggaaaggactcatccatcaatataaagaatatttgccagtaacggac
aaaacaccggaattgacgctgaacgagggaaataccccgcttatttatctgcaaaacctt
tcgaaaaagctcggaatcgagctttatgtcaagacggagggtgtcaaccctacaggctcc
tttaaagaccgcgggatggtcatggcggtcgccaaggcgaaagaagaaggcaatgacacg
atcatgtgcgcttcgaccggcaatacgtcggctgctgcggcggcttatgcggcccgcgcc
aacatgaagtgcatcgtcattattccagacggcaaaatcgccttcggaaaattggcccaa
gccgtcatgtacggcgcagaaatcattgcgatcgacggaaacttcgacgatgccctgaaa
atggtgcgcagcatttgcgagaaagagccgattgcgctggtcaactctgtgaatccatac
cggattgaaggacagaaaaccgcttcctttgaaatttgtgaacagctgggcgaagcgcct
gatatcctagcgattcctgtcggaaatgccggtaatataacggcttactggaaaggcttt
aaagagtatcatgagaaaaacggcacaggcctgccggtcatgaagggttttcaggcggaa
ggcgcggccccgattgtcaaaaacaaagtaattgaaaagccggaaaccgttgcgacagcg
atcagaatcggaaatccggctagctgggataaagcggtcaacgctgcaaaagaatcgaac
ggtaaaatcgatgcagtgtcagacgaggagattctccacgcttatcagctcctggcaaga
gaagaaggcgtatttgcagaaccgggatcatgcgcatccattgcgggcgtgctgaaacag
ctgcaaacgaaagagattcagccgggtgcgaaagtggttgccgtcttaaccggaaacggc
ctgaaagatccgaacacagccgttgatgtgtcgcagatcaaacctgtcacactgccgaca
gacgaagaagctattctcgaacacttaaaaggagccgctcgtgtatga

DBGET integrated database retrieval system