KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03550Help
Entry
BLi03550          CDS       T00200                                 

Gene name
fruA2
Definition
fructose-specific phosphotransferase system EIIC component FruA (EC:2.7.1.- 2.7.1.69)
Orthology
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Fructose and mannose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bld00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:bld02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3395690..3397090
Genome map
AA seq 466 aa AA seqDB search
MKKFKIIAATGCPTGIAHTFMAEEALKQAAAKLGVEIKVETHGQIGVQNELSPEDIKQAD
GVIVAADKDVGAERFAGKRVLDVPVARGIRDAESLIRTLMNGEAPIYRGQTAAKTEDEPK
TGESASIGRKIYKHLMNGVSHMLPFVVGGGVLIALSFLFGIHSADPEHPSYNAFAELLNK
TGAFGFQLMVPILSAYIADSMAKRPGLIVGFIGGMIASTGGAGFLGGIVSGFLAGLIIYG
LSHALKKMPQSLEGLKAIFLYPVIGIFLIGAVMFFLVEPMTAINEGMKGFLADFQGANPI
ILGLIIGCMSAFDMGGPVNKAAYVTGTALLAEGNQYFMAGVSAACITPPLVIAFATLLFR
KYFSQQDRNAGLVNFILGATHITEGAIPFAAKKPIPVIPILMIGSSVSAILTYSFAVQVP
APHGGFLVLPVVTGAFQWVLSIIIGSLIGAFLYGFYQKRTYEKEKG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttcaaaatcatcgcggcaaccggctgtccaacagggattgcccatacattt
atggctgaagaggccttaaaacaggctgccgccaaactgggtgtggaaatcaaagtcgaa
acacacgggcaaatcggcgttcaaaacgaactatcgccagaggacattaaacaagccgac
ggggtcattgtcgcggcagacaaagatgtaggcgcagagcgttttgcaggcaaacgtgtc
cttgacgtcccggttgcgcggggcatccgggatgcggaatctttaattcggacgctgatg
aacggcgaagcgccgatttaccgcggacaaactgcggcaaaaacagaggatgaaccaaaa
acaggcgaatccgcttccatcggccgtaaaatatataaacatttgatgaacggggtttcc
cacatgctcccatttgtcgtcggcggaggggttttgattgcactttcctttttattcggc
atccattcagcggatcctgaacatccaagctacaacgcttttgccgaattgctgaataaa
acgggcgcattcggattccagctgatggttccgattttatccgcctatatcgccgattca
atggcaaaacgccccggcctgattgtcggttttatcggcggcatgatcgccagcacgggc
ggagcgggttttctgggcggcatcgtatccggttttttggcgggactgatcatttacggc
ctctcgcatgcacttaaaaaaatgcctcagtcacttgaaggactaaaagcaatttttctt
tatccggttatcggcatttttctgatcggtgcggtcatgtttttcctcgtcgaaccgatg
acggccattaatgaggggatgaagggctttttagccgactttcaaggggcgaacccaatc
attctcggcttgatcatcggctgtatgagcgcatttgacatgggcggcccggtcaataaa
gccgcttatgtcaccggtactgctcttctcgctgaagggaaccaatatttcatggcaggc
gtctccgccgcgtgcatcacaccgccgctcgttattgcgtttgccacattgcttttccgc
aaatatttcagccagcaggaccgaaatgcaggacttgtcaattttattctcggcgccact
catattactgaaggcgctatcccgttcgccgcaaagaaaccaatccctgtcattccgatt
ttgatgatcggctcttcggtttcggcaatattaacatattcattcgcagttcaagtacct
gccccgcacggcggattccttgtacttcccgttgtaacaggagcctttcaatgggtgctg
tcgattatcatcggatcgcttatcggtgccttcttatacggcttttaccaaaaacggaca
tatgaaaaagagaaaggctga

DBGET integrated database retrieval system