KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03550Help
Entry
BLi03550          CDS       T00200                                 

Gene name
fruA2
Definition
fructose-specific phosphotransferase system EIIC component FruA (EC:2.7.1.- 2.7.1.69)
Orthology
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Fructose and mannose metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BLi03550 (fruA2)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    BLi03550 (fruA2)
Enzymes [BR:bld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     BLi03550 (fruA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3395690..3397090
Genome map
AA seq 466 aa AA seqDB search
MKKFKIIAATGCPTGIAHTFMAEEALKQAAAKLGVEIKVETHGQIGVQNELSPEDIKQAD
GVIVAADKDVGAERFAGKRVLDVPVARGIRDAESLIRTLMNGEAPIYRGQTAAKTEDEPK
TGESASIGRKIYKHLMNGVSHMLPFVVGGGVLIALSFLFGIHSADPEHPSYNAFAELLNK
TGAFGFQLMVPILSAYIADSMAKRPGLIVGFIGGMIASTGGAGFLGGIVSGFLAGLIIYG
LSHALKKMPQSLEGLKAIFLYPVIGIFLIGAVMFFLVEPMTAINEGMKGFLADFQGANPI
ILGLIIGCMSAFDMGGPVNKAAYVTGTALLAEGNQYFMAGVSAACITPPLVIAFATLLFR
KYFSQQDRNAGLVNFILGATHITEGAIPFAAKKPIPVIPILMIGSSVSAILTYSFAVQVP
APHGGFLVLPVVTGAFQWVLSIIIGSLIGAFLYGFYQKRTYEKEKG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttcaaaatcatcgcggcaaccggctgtccaacagggattgcccatacattt
atggctgaagaggccttaaaacaggctgccgccaaactgggtgtggaaatcaaagtcgaa
acacacgggcaaatcggcgttcaaaacgaactatcgccagaggacattaaacaagccgac
ggggtcattgtcgcggcagacaaagatgtaggcgcagagcgttttgcaggcaaacgtgtc
cttgacgtcccggttgcgcggggcatccgggatgcggaatctttaattcggacgctgatg
aacggcgaagcgccgatttaccgcggacaaactgcggcaaaaacagaggatgaaccaaaa
acaggcgaatccgcttccatcggccgtaaaatatataaacatttgatgaacggggtttcc
cacatgctcccatttgtcgtcggcggaggggttttgattgcactttcctttttattcggc
atccattcagcggatcctgaacatccaagctacaacgcttttgccgaattgctgaataaa
acgggcgcattcggattccagctgatggttccgattttatccgcctatatcgccgattca
atggcaaaacgccccggcctgattgtcggttttatcggcggcatgatcgccagcacgggc
ggagcgggttttctgggcggcatcgtatccggttttttggcgggactgatcatttacggc
ctctcgcatgcacttaaaaaaatgcctcagtcacttgaaggactaaaagcaatttttctt
tatccggttatcggcatttttctgatcggtgcggtcatgtttttcctcgtcgaaccgatg
acggccattaatgaggggatgaagggctttttagccgactttcaaggggcgaacccaatc
attctcggcttgatcatcggctgtatgagcgcatttgacatgggcggcccggtcaataaa
gccgcttatgtcaccggtactgctcttctcgctgaagggaaccaatatttcatggcaggc
gtctccgccgcgtgcatcacaccgccgctcgttattgcgtttgccacattgcttttccgc
aaatatttcagccagcaggaccgaaatgcaggacttgtcaattttattctcggcgccact
catattactgaaggcgctatcccgttcgccgcaaagaaaccaatccctgtcattccgatt
ttgatgatcggctcttcggtttcggcaatattaacatattcattcgcagttcaagtacct
gccccgcacggcggattccttgtacttcccgttgtaacaggagcctttcaatgggtgctg
tcgattatcatcggatcgcttatcggtgccttcttatacggcttttaccaaaaacggaca
tatgaaaaagagaaaggctga

DBGET integrated database retrieval system