KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03642Help
Entry
BLi03642          CDS       T00200                                 

Gene name
est
Definition
carboxylesterase Est (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Brite
Enzymes [BR:bld01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BLi03642 (est)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3472540..3473286)
Genome map
AA seq 248 aa AA seqDB search
MKIVKPQPFTFKGGKKAVLLLHGFTGNTADVRMLGRYLNEKGYTCHAPQYKGHGVPPEEL
LSTGPEDWWKDVMDGYEYLKSEGYEQIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMYI
KSEETMYEGVLDYARNYKKFEGKTAEQINAEMEEFKKTPMNTLKALQDLIADVREHVDMI
YSPTFVVQARHDHMINTDSANIIYNEVETDDKQLKWYEESGHAITLDKERETLHKDVYQF
LETLDWQT
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtcaaaccacaacctttcacatttaaaggcggaaaaaaagccgtcctgctg
ctgcacggatttacgggcaacacggcggacgttagaatgctcggaagatatttgaatgaa
aaaggctacacatgccatgcgccccaatataaaggccacggcgtgcctccagaagaactt
ctctccacaggaccggaagactggtggaaagacgtcatggacggatatgaatatctgaaa
tcggaaggatatgaacaaatcgccgcttgcggactgtctctcggaggggttttttcattg
aaattgggttacactgtacccataaagggaattgttccaatgtgcgcgccgatgtacatc
aaaagcgaagagacgatgtacgagggtgtgcttgattatgcccgcaattataagaaattt
gaaggcaagacagcggagcagattaacgctgagatggaagaattcaaaaaaacgccgatg
aacacgttgaaagcactgcaggatttgattgccgatgtcagagagcatgtggacatgatc
tattcgcctacatttgtcgtgcaggcgcgccacgatcatatgattaatacggatagcgca
aacatcatctacaatgaagttgaaacggatgataagcagctgaaatggtatgaagaatca
ggtcatgccatcacattggataaagaacgcgaaacactgcacaaggatgtgtatcaattt
ttagaaacgttggattggcagacataa

DBGET integrated database retrieval system