KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03663Help
Entry
BLi03663          CDS       T00200                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLi03663 (tpiA)
   01230 Biosynthesis of amino acids
    BLi03663 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLi03663 (tpiA)
   00051 Fructose and mannose metabolism
    BLi03663 (tpiA)
   00562 Inositol phosphate metabolism
    BLi03663 (tpiA)
Enzymes [BR:bld01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BLi03663 (tpiA)
Exosome [BR:bld04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BLi03663 (tpiA)
  Exosomal proteins of bladder cancer cells
   BLi03663 (tpiA)
  Exosomal proteins of melanoma cells
   BLi03663 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3489184..3489945)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKVLSEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLTSAVKGTDLK
VGAQNMHFEESGAFTGEISPAALKDLGVEYCVIGHSERREMFAETDETVNKKAHAAFKYG
IVPIICVGETLEEREANKTNELVADQVKKALAGLTTEQVAASVIAYEPIWAIGTGKSSTA
QDANEVCAHIRKTVASEFGQTAADSVRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEAGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatagccggtaactggaagatgaataaagtgctttcagaagctgtc
agcttcgttgaagaagtgaaatcttccattcccgcagcagataaagcagaagctgttgtc
tgtgcgcctgcactgttccttgaaaagctcacatcagctgtaaaaggcacagatctgaaa
gtcggcgcgcaaaacatgcattttgaagaaagcggagctttcacgggtgaaatcagccct
gcggctttgaaagaccttggagttgaatactgcgtcatcggccactccgagcgccgcgaa
atgtttgctgaaacggatgaaacggtcaacaaaaaagcgcatgctgcatttaaatacggc
atcgttccgatcatctgcgtaggtgaaacgcttgaagagcgcgaagcaaacaaaacaaac
gagcttgttgcagaccaagtgaaaaaagcacttgcaggtttaacaactgaacaggtagct
gcttccgtgatcgcttatgagccgatctgggcgattggaaccggcaagtcttcaactgca
caagatgcaaacgaagtatgcgcgcacatccgcaaaaccgtggcatcagagttcggacaa
actgcagcagacagcgtccgcattcagtacggcggaagcgtaaaacctgcgaacattaaa
gaatatatggccgaatccgatatcgacggcgctcttgttggcggagcaagccttgagccg
cagtctttcgtgcaattattggaggcaggtcaatatgagtaa

DBGET integrated database retrieval system