KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03736Help
Entry
BLi03736          CDS       T00200                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase HisD
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00340  Histidine metabolism
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01230  Biosynthesis of amino acids
Module
bld_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BLi03736 (hisD)
Enzymes [BR:bld01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BLi03736 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AAU42555
UniProt: Q65EF9
Position
complement(3559342..3560622)
Genome map
AA seq 426 aa AA seqDB search
MKIKSISGNTSVSLKRSIDAGTEEQRKAVRGIIEEVKKNGNAAVSAFTRQFDGADVAGFR
VSEEEIKEAYSALEERDLEIIQAAIFNIKEYHERQLATSWFYHRKDGTMLGQKITPLDSA
GVYVPGGTAAYPSSVLMNVIPALVAGVDRIVLASPPGKDGKLSAGVLAAAAELGVTEIYK
MGGAQAIAALAYGTETITPVDKITGPGNIYVALAKREVFGQVDIDMIAGPSEIAILADST
ANYREIAADLLSQAEHDAMASSILVTDSETLAESVLKEVYRQLEHLPRKEIARQSIDNYG
LIYVTETMNEAVSVINELAPEHLEILTVQPDALLGQIKHAGAIFLGRYSSEPVGDYFAGP
NHVLPTNGTARFSSPLNVTDFQKRSSIISYSREAFRANAEKIAAFARLEGLEAHARAIES
RNREED
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaaatccatcagcggaaatacgtcggtttcactaaaacgctctattgacgcc
ggaacggaggaacaaagaaaagcagtccgcggcattatcgaagaagtgaaaaagaacgga
aatgcagctgtttccgcattcacaagacaatttgacggagcggatgtggccggctttcgc
gtttccgaagaggaaatcaaggaagcatacagcgcgctcgaagaacgtgatctcgagatt
attcaggcggcgattttcaacattaaagaatatcatgagcgtcagctcgcaacatcttgg
ttttaccaccgcaaggacggaacgatgctcggccaaaaaattacgccgcttgattcagcg
ggggtgtatgtgcccggcggaacggctgcttacccatcatccgttctgatgaatgtcatt
ccggcgcttgttgcaggcgtcgaccgcattgtccttgcctcacctccgggaaaagacggt
aaattgtcggcgggagtgctggctgctgctgcggagcttggcgtcacagagatttacaaa
atgggcggtgcccaagcgattgccgcattggcttacggaacggaaacgattacccccgtc
gataaaattacgggacccggaaatatttacgtcgccttggctaaacgggaagtattcggc
caggttgatatcgatatgatcgcgggtccaagtgaaatcgccatactcgctgacagtacg
gcaaactaccgggaaatcgccgcagatctactttcacaggctgaacacgatgcgatggca
tcgagcattcttgtcaccgattcagagacgcttgccgaatccgttttaaaagaggtttac
agacagctcgaacatcttccgagaaaagagattgcacggcagtcgattgacaactatggc
ctgatctatgttacagagacgatgaatgaagcagtttccgtcatcaatgagctcgctcct
gaacatttggaaattttaacagttcaacccgatgcgctgctgggacagatcaaacatgcg
ggcgccattttcctgggccgctacagttcagagccggtgggcgattattttgcaggccct
aatcatgtcctgccgactaacggtacagccagattttcaagcccgctaaatgtgacagac
ttccaaaagcgctccagcatcatttcctacagcagggaagctttccgcgcgaatgctgag
aaaattgcggcctttgccagattggaagggcttgaagcccatgcaagagcaattgaatcc
agaaaccgggaggaagactga

DBGET integrated database retrieval system