KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03813Help
Entry
BLi03813          CDS       T00200                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase GtaB (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BLi03813 (gtaB)
   00052 Galactose metabolism
    BLi03813 (gtaB)
   00500 Starch and sucrose metabolism
    BLi03813 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BLi03813 (gtaB)
Enzymes [BR:bld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BLi03813 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3633514..3634392
Genome map
AA seq 292 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKS
KRAIEDHFDFSPELERNLEEKGKIELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAEKPGLRQLMDEYEKTLSSVIGVQQVPEDQTHRYGIIDPLTNEG
RLYQVKNFVEKPKPGTAPSNLAILGRYVFTPEIFMYLDKQQIGAGGEIQLTDAIQKLNEI
QRVFAYDFEGKRYDVGEKLGFIQTTLEFAMQDDELKDSLIPFMQDLLAKEEV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaagttcgtaaagcgatcattcccgcagcgggccttggaacacgtttcctccct
gcaacgaaagcgatgccaaaggaaatgcttccaatcgtagataagccaaccattcaatat
attattgaagaagccgttgaagccggcattgaagacattatcatcgtaaccggtaaaagc
aaacgagcgattgaagatcatttcgatttctcgccggagctcgaacgcaacctggaggaa
aaagggaaaatcgaactccttgaaaaagtgaaaaaagcgtcaaatctcgctgatatccac
tatattcgccaaaaagaaccaaaaggactcggacatgccgtttggtgcgcccgcaacttt
atcggagacgagccgttcgcagtgctccttggagacgacattgtccaagccgaaaaacct
ggccttcgccagctgatggacgagtacgaaaagactctctcatccgtaatcggcgttcag
caggtgcctgaagaccaaacgcaccgctacgggatcattgatcctttgacaaatgaaggg
cgcctataccaggtcaaaaactttgttgaaaaaccaaaaccgggcacagcaccgtctaac
cttgcgattttgggacgctatgtctttactcctgaaattttcatgtacttagataaacag
caaatcggcgcaggcggagagatccagctgacagatgcgattcagaagttaaacgaaatc
cagcgcgtattcgcttatgacttcgaaggcaaacgctatgacgttggagaaaaactcggt
tttatccagacaactctcgaatttgccatgcaggacgacgaactgaaggattcgctgatt
ccatttatgcaggaccttctggcaaaagaagaagtttaa

DBGET integrated database retrieval system