KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03813Help
Entry
BLi03813          CDS       T00200                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase GtaB (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bld00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bld00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bld00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bld00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3633514..3634392
Genome map
AA seq 292 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKS
KRAIEDHFDFSPELERNLEEKGKIELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAEKPGLRQLMDEYEKTLSSVIGVQQVPEDQTHRYGIIDPLTNEG
RLYQVKNFVEKPKPGTAPSNLAILGRYVFTPEIFMYLDKQQIGAGGEIQLTDAIQKLNEI
QRVFAYDFEGKRYDVGEKLGFIQTTLEFAMQDDELKDSLIPFMQDLLAKEEV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaagttcgtaaagcgatcattcccgcagcgggccttggaacacgtttcctccct
gcaacgaaagcgatgccaaaggaaatgcttccaatcgtagataagccaaccattcaatat
attattgaagaagccgttgaagccggcattgaagacattatcatcgtaaccggtaaaagc
aaacgagcgattgaagatcatttcgatttctcgccggagctcgaacgcaacctggaggaa
aaagggaaaatcgaactccttgaaaaagtgaaaaaagcgtcaaatctcgctgatatccac
tatattcgccaaaaagaaccaaaaggactcggacatgccgtttggtgcgcccgcaacttt
atcggagacgagccgttcgcagtgctccttggagacgacattgtccaagccgaaaaacct
ggccttcgccagctgatggacgagtacgaaaagactctctcatccgtaatcggcgttcag
caggtgcctgaagaccaaacgcaccgctacgggatcattgatcctttgacaaatgaaggg
cgcctataccaggtcaaaaactttgttgaaaaaccaaaaccgggcacagcaccgtctaac
cttgcgattttgggacgctatgtctttactcctgaaattttcatgtacttagataaacag
caaatcggcgcaggcggagagatccagctgacagatgcgattcagaagttaaacgaaatc
cagcgcgtattcgcttatgacttcgaaggcaaacgctatgacgttggagaaaaactcggt
tttatccagacaactctcgaatttgccatgcaggacgacgaactgaaggattcgctgatt
ccatttatgcaggaccttctggcaaaagaagaagtttaa

DBGET integrated database retrieval system