KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03841Help
Entry
BLi03841          CDS       T00200                                 

Gene name
rbsK
Definition
ribokinase RbsK (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BLi03841 (rbsK)
Enzymes [BR:bld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BLi03841 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3669357..3670244
Genome map
AA seq 295 aa AA seqDB search
MTMSKICVIGSSSMDLVVTSPKRPAAGETVLGESFKTVPGGKGANQAVAAARLGAEVHMI
GCVGDDHYGKAILDNFQANGVLTDYVEPVTGQESGTAHIVLADGDNSIIVVKGANDHVTP
EYVQKALPAIKQADIVLIQQEIPEETVDYVSGLCSSLGIPLLLNPAPARPLRPETVEHAA
YITPNEHEASVLFQGMSREEALKRYPEKLFITEGKNGVRYHNGLEERVVPSFPVNAIDTT
GAGDTFNAGFAVALSEGQSIESALRFANRAASLSVLKFGAQGGMPKRDEVERELS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgagtaaaatatgcgtgatcggcagctcttcgatggatttagtcgtgacatcg
cccaagcggccggccgccggagaaacggtgcttggcgaatcttttaaaacggttccgggc
ggaaagggggccaaccaagcggtagccgcggcccggcttggcgccgaggtccatatgatc
ggctgcgtcggcgatgatcattacgggaaagccatcctcgacaattttcaagccaatggt
gtcttgacagactatgtggaaccggttacaggtcaggaaagcggaaccgcacatatcgtt
ctcgcagacggcgacaacagcattatcgtcgtcaaaggggcaaatgaccatgtcacacct
gaatacgttcaaaaagcgctgcctgcgattaaacaggcagacatcgttctgattcagcag
gagattccggaagaaaccgtcgattatgtcagcggactgtgcagctctctcggcattcct
ctcctgctgaatccggcaccagcccgtccgctacgcccggaaacggtcgaacacgcggcc
tacatcacgccaaacgagcatgaagcttcggtactgtttcagggcatgtcccgggaggaa
gcgttaaagcgctatccggagaagctgttcatcacagaagggaaaaacggcgtccgctat
cacaatggtctggaagaacgtgtcgttccttcattccctgtcaatgcgattgatacgacg
ggcgccggagacaccttcaatgcgggatttgccgtcgcgctttccgaaggacaaagcatc
gaatctgccttgcgctttgcgaaccgggcggcttccctgtcggttctgaaattcggcgca
caaggcggcatgccaaaacgggatgaagtggagcgtgaactgtcatga

DBGET integrated database retrieval system