KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03954Help
Entry
BLi03954          CDS       T00200                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BLi03954 (tdk)
Enzymes [BR:bld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BLi03954 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3779017..3779601)
Genome map
AA seq 194 aa AA seqDB search
MYIMKQSGWLELICGSMFSGKSEELIRRIKRATFAKQEVKVFKPAIDNRYSSESVVSHNG
TSIVCHAIASPEEIFQYISKETDVIGVDEVQFFDETIVGTLTSLADQGYRVIAAGLDLDF
RGEPFGVVPDLMALAETVTKLQAVCSVCGSPASRTQRLINGKPASYDDPVILVGASEAYE
ARCRHHHEVPGNPK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcatgaagcaaagcggctggcttgaactcatatgcggaagcatgttttcgggc
aaatcagaggagctcatccgccggatcaaaagggcgacgtttgcgaagcaggaagtcaaa
gtgtttaaaccagccattgataatcgctacagcagcgaatcggttgtatcgcataatggg
acatccattgtgtgccatgccatcgcatctccggaagaaatttttcaatacataagcaaa
gaaacggatgtcatcggcgtcgatgaagtgcagttttttgacgaaacgattgtcggcacg
ttaacttctctggctgatcagggctaccgtgtgattgcagcaggccttgatttggatttc
cggggcgagcctttcggcgtcgtgcccgatctgatggctttagcggaaacggtgaccaag
ctgcaagccgtgtgctctgtctgcggatctccagccagccgcacgcagaggctgatcaat
ggaaaacctgcttcttatgacgatccggtcattttggttggggcctccgaagcatatgaa
gcgcgctgccgccaccatcatgaagtgcctggaaacccgaaatga

DBGET integrated database retrieval system