KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi04199Help
Entry
BLi04199          CDS       T00200                                 

Definition
family 1 glycoside hydrolase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bld00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4028632..4030050)
Genome map
AA seq 472 aa AA seqDB search
MKYKTLAQFPKDFLWGASTSAYQVEGAWDEDGKGPSVIDARESYPEGTTDFKVASDHYQR
YKEDIALFAEMGFKAYRFSIAWTRIIPDGDGDINPKGIEFYSRLIDELLKYGIEPIVTMY
HFDLPNALQKKGGWSDRATIDAFEKYAKVLFESYGDRVKYWLTINEQNMMILHGSALGTL
DPNLENPKKELYQQNHHMLVAQAKAIKLCHEMLPEAKIGPAPNIALIYPASSKPEDVLAA
FNYNAIRNWLYLDMAVFGRYNTTAWAYMKEKGCTPVIAEGDMDILRSAKPDFIAFNYYTS
QTAEASRGDGSDTAARGGDQHLQTGEEGVYRGSSNPHLKKNAFGWEIDPVGFRSTLREIY
DRYQLPLIVTENGLGAFDQLEDGDVVNDDYRIDYLKEHIKQIQLAITDGVDVFGYSPWSA
IDLISTHQGCSKRYGFIYVNRDEFDLKDLRRIRKKSFYWYKNLIATNGETLD
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataaaacattagctcaatttccgaaagattttttgtggggcgcgtctacttcc
gcttatcaagtggaaggcgcttgggacgaagatggaaaagggccttctgtcatcgatgcg
cgcgaaagctacccggaagggacaaccgattttaaagtcgcaagcgaccattaccagcgc
tataaagaagatatcgctttatttgcggaaatgggcttcaaagcgtaccgtttttcgatt
gcctggacgcgcatcattccggacggggacggtgatattaatccgaagggaatcgaattt
tacagccgtttgatcgatgaacttctaaagtatggaatcgaaccaattgttacgatgtac
cactttgatctgccgaatgctttgcagaaaaaaggcggctggtcggacagggccacgatt
gatgcttttgaaaagtatgcgaaggtcctttttgaaagctacggtgaccgcgtcaaatac
tggctgaccatcaatgagcaaaatatgatgatcctccacggatctgcactcggtacactc
gatccgaacttggaaaatccgaaaaaagagctttatcagcaaaaccatcacatgctcgtc
gcacaggcgaaagcgatcaagctttgccatgagatgctgccggaagcaaaaatcggtcct
gcgccgaatattgcgctcatctatcccgcttcttcgaaaccggaggacgtgctggcggct
tttaactataatgcgatccgaaactggctttacttggatatggccgtattcggacggtac
aatacaacagcgtgggcatatatgaaagaaaaaggctgcacaccggtcatcgctgaaggg
gatatggacattctgcggtcggccaagccggattttatcgcgtttaactactatacatcg
caaacggctgaagcaagcaggggtgatggcagcgacacggctgctcgaggcggagaccag
catttgcagacgggagaagaaggcgtatataggggaagcagcaatccgcacctaaagaaa
aacgcatttggctgggagatcgaccctgtcggtttccgttcgacgctgcgcgaaatttac
gaccgctaccagctgccgctgatcgtcactgagaacggcctcggcgcgtttgatcagctt
gaagacggagatgtcgtaaatgacgattaccgcatcgattatttaaaagagcatatcaag
caaattcagctggcaatcacggatggagtcgatgttttcggctactccccatggtctgcc
atcgacttaatttcgacccatcaaggctgttcaaaacgctacggatttatttatgtgaac
cgcgatgaatttgatttgaaagacttgcgccgcattcgcaaaaaaagcttttactggtat
aaaaacctgattgctacaaacggcgaaacactcgattaa

DBGET integrated database retrieval system