KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi04207Help
Entry
BLi04207          CDS       T00200                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase AceA
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00630  Glyoxylate and dicarboxylate metabolism
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01120  Microbial metabolism in diverse environments
bld01200  Carbon metabolism
Module
bld_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BLi04207 (aceA)
Enzymes [BR:bld01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BLi04207 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AAU43020
Position
complement(4037447..4038718)
Genome map
AA seq 423 aa AA seqDB search
MLKEKQLAESWEHDERWKGITRPYEAADVIRLRGTLEIEYTIARRGAEKLWKLLHTEDFV
PALGALTGNQAMQQVKAGLKAIYLSGWQVAADANMSGSMYPDQSLYPANSVPEVVKKINR
TLQRADQIHHMEGKEDIDWFAPIVADAEAGFGGQLNVFELMKSMIEAGAAGVHFEDQLSS
EKKCGHLGGKVLLPTQTAVRNLIAARLAADVMGVPTILIARTDANAADLITSDVDSYDAP
FLTGERTAEGFFKTKPGLDQAIARGLAYAPYADLIWCETSEPNIEEARRFAQAIHEKFPG
KLLAYNCSPSFNWKAKLDDNTILNFQKQLSEMGYKFQFVTLAGFHALNHGMFELARQYKH
RGMAAYSDLQQAEFASEVHGYTATRHQREVGTSYFDEVAQVVTGGTSSTTALKGSTEAEQ
FQS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagaaaaacaactcgcagaaagctgggagcatgatgaacgctggaaagggatc
acaaggccgtatgaggcggcagacgtcattcggctgaggggcacgctcgagattgaatac
acgattgcaaggcgcggcgccgaaaagctgtggaagcttctccatacagaggatttcgtc
ccggcgctgggcgctttgaccggaaaccaagccatgcagcaagtaaaggccggattgaaa
gcgatttatttaagcggctggcaggtggctgccgatgcaaatatgtcagggagcatgtat
cctgaccaaagcctttatccggcaaacagcgtcccggaagtcgtcaaaaaaatcaaccgc
acgctgcagcgcgccgatcaaatccaccatatggaaggaaaggaagacatcgattggttt
gctccgattgtggccgacgctgaagcgggcttcggcgggcagctgaatgtgttcgagctg
atgaaaagtatgattgaagccggcgccgcgggagttcactttgaagaccagctgtcgtct
gagaaaaagtgcgggcatttgggcggaaaagtgctgcttccgacgcaaacagcggtacgt
aatttgattgccgcgcgcctcgccgcagacgtgatgggagtcccgaccattcttattgcc
cgcacggacgcgaatgcggcagacctgatcacaagcgacgtcgattcatatgatgcaccg
tttttgacgggagagcgaacagcggaagggttcttcaaaacaaagcctggccttgatcag
gcgattgccagaggcttggcgtatgcgccgtatgccgatttgatctggtgtgaaacgtct
gagccgaatattgaagaagcccgccggtttgcacaggcgatccatgaaaaattcccgggc
aaactgctcgcctacaactgttccccttcgttcaactggaaggccaaactggatgacaac
acgatcttgaacttccagaaacagctcagtgaaatgggctataaatttcaatttgtcaca
ctggcgggcttccacgccttaaatcacggcatgtttgaattggcccgccaatataagcac
cgcggaatggcggcgtactctgatctgcagcaggccgagtttgccagcgaagtccacggc
tatacggcgacaaggcatcagcgcgaagtcggaacgagctactttgatgaagtcgcccag
gttgtgacaggcgggacttcatcaaccactgcactgaagggatcgactgaagcggaacag
tttcaatcataa

DBGET integrated database retrieval system